DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and fgg

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_002933524.1 Gene:fgg / 100038189 XenbaseID:XB-GENE-478355 Length:438 Species:Xenopus tropicalis


Alignment Length:225 Identity:72/225 - (32%)
Similarity:116/225 - (51%) Gaps:35/225 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NGIHQLM-LPEEEPFQV-TQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFG--DPNG--EFFI 89
            :|::.:. |..::.|.| .:.:.:...|.|.||||||||:|:::|..||:|||  .||.  ||::
 Frog   187 SGLYYIKPLKAKQQFLVYCEIEPSGSAWTVFQRRLDGSVDFHKNWNQYKEGFGYLSPNDKTEFWL 251

  Fly    90 GLQKLYLMTREQ--PHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDS---- 148
            |.:|::|::.:.  |:.:.|:|:........|.:..|:|.||.:.|:........|.|||:    
 Frog   252 GNEKIHLISTQSAIPYVMRIELEDWSNQKSTADYSTFRVGSEKDNYRFTYAYFIGGDAGDAFDGF 316

  Fly   149 ----------LRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFR-------- 195
                      ...|...:|||:|||||:...|||.:.|.|||.:.|.::.|||.|::        
 Frog   317 DFGDDPSDKFFTSHNGMQFSTYDRDNDKFEGNCAEQDGSGWWMNRCHAAHLNGKYYQGGSYTEAD 381

  Fly   196 EGETGMLNGIHWGRWK-----FQSLTFVQI 220
            .|.:|..|||.|..|:     .:|:|...|
 Frog   382 SGTSGYDNGIIWATWRSRWYSMKSVTMKMI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 72/225 (32%)
fggXP_002933524.1 Fib_alpha 29..169 CDD:370076
FReD 172..413 CDD:238040 72/225 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.