DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and fga

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_002933535.3 Gene:fga / 100038060 XenbaseID:XB-GENE-478771 Length:761 Species:Xenopus tropicalis


Alignment Length:224 Identity:84/224 - (37%)
Similarity:131/224 - (58%) Gaps:29/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SGSPNGIHQLMLPEEEPFQVTQC--KTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPN----G 85
            ||:.:||.::............|  .|....||:||:|.|||||||::|..||:|||..:    |
 Frog   536 SGAKSGIFKIRPEGSTKVLSVYCDQDTQLGGWILIQQRQDGSVNFNRTWQDYKNGFGSVDAGGKG 600

  Fly    86 EFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSL- 149
            |.::|.:.::|:|::.. .|.|:|:...|..|||.: :.|:.||.|.:.| :|.:|.|||||:| 
 Frog   601 EVWLGNENIHLLTQKDT-ILRIELEDWSGEKVYAEY-NIQLGSEAEGFTL-KVSQYEGTAGDALI 662

  Fly   150 -------RY--HINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETG----- 200
                   .|  |||.:|||:|||:|:..:|||..:|||||:::|.:|:|||:|:..|:..     
 Frog   663 EGSKEDGEYTSHINMKFSTYDRDSDKWEENCAEMYGGGWWYNNCQASNLNGIYYIGGQYDPRNNF 727

  Fly   201 ---MLNGIHWGRWKF--QSLTFVQIMIRP 224
               :.||:.|..:|.  .||..|::.:||
 Frog   728 PYEIENGVVWVPFKAADYSLKTVRMKMRP 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 83/223 (37%)
fgaXP_002933535.3 Fib_alpha 51..191 CDD:400857
Fibrinogen_aC 299..372 CDD:403400
FReD 523..757 CDD:238040 84/224 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.