DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and mfap4.3

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_001339903.1 Gene:mfap4.3 / 100007474 ZFINID:ZDB-GENE-110408-14 Length:242 Species:Danio rerio


Alignment Length:221 Identity:88/221 - (39%)
Similarity:118/221 - (53%) Gaps:16/221 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLFLWTLLFEV----GQSSPHTC----PSGSP-NGIHQLMLPEEEPFQV-TQCKTTARD-----W 56
            ||||.|||...    ..|.|..|    .||.. :|::.:....|.|..| .|..:..:|     |
Zfish     4 VLFLATLLSAALASDCTSMPFDCSDIYKSGETLSGVYTIYPAGETPVWVYCQMLSDGKDEENGGW 68

  Fly    57 IVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHF 121
            .|||||:||||||.:.|..||.|||:..||:::||:.||.:||.:...|.:.|:...|...:|.:
Zfish    69 TVIQRRMDGSVNFYRPWRDYKRGFGNVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQY 133

  Fly   122 DDFQVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLS 186
            ..|.|..|.|.|||:..|...|.|||||..|...:|||||:|.|...||||.|..||:|:.||.:
Zfish   134 SSFSVGCECEGYKLQVSGFTDGGAGDSLSPHNGMKFSTFDKDQDTYEKNCAKEFLGGFWYSSCHN 198

  Fly   187 SSLNGLY-FREGETGMLNGIHWGRWK 211
            ::.|.:| :.|..|....|:.|..||
Zfish   199 TNPNAVYLWEEDVTHHAIGVSWYSWK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 77/192 (40%)
mfap4.3XP_001339903.1 FReD 23..239 CDD:238040 80/202 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.