DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and mfap4.12

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_001339837.3 Gene:mfap4.12 / 100007462 ZFINID:ZDB-GENE-110408-35 Length:247 Species:Danio rerio


Alignment Length:227 Identity:81/227 - (35%)
Similarity:123/227 - (54%) Gaps:16/227 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSCFFVLFLWTLLFEVG----QSSPHTC----PSGSP-NGIHQLMLPEEEPFQV-TQCKTTARD 55
            |.|..|::.|.:::...|    :.||..|    .:|.. :|::.:....:.|..| .|..:..:|
Zfish     3 MTSMVFLVALLSIVLVNGCSEDEDSPVDCSELNKAGETLSGVYTIHPAGDAPVWVYCQMVSDGKD 67

  Fly    56 -----WIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGA 115
                 |.|||||:||||||.:.|..||.|||:..||:::||:.||.:||.:.|.|.:.|:...|.
Zfish    68 EENGGWTVIQRRMDGSVNFYRPWRDYKRGFGNLEGEYWLGLENLYQLTRHKDHMLRVDLEDFEGR 132

  Fly   116 TVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWW 180
            ..:|.:..|.|..||:.|:|:..|...|.||||:.||...:|||||:|.|...|:||..:.|.:|
Zfish   133 KGFAQYSSFSVGCETDGYQLQVSGFTDGGAGDSMTYHNGMKFSTFDKDQDNFDKSCARLYLGAFW 197

  Fly   181 FHSCLSSSLNGLY-FREGETGMLNGIHWGRWK 211
            :.:|..::.||:| :.|..|....|..|..||
Zfish   198 YDNCHHANPNGVYLWGEDATIFAIGNVWYGWK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 73/192 (38%)
mfap4.12XP_001339837.3 FReD 26..244 CDD:238040 76/204 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48118
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.