DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31827 and Tpsg1

DIOPT Version :10

Sequence 1:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:137 Identity:24/137 - (17%)
Similarity:53/137 - (38%) Gaps:43/137 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KHLIGIYKQFLPQSIQFVSLLQNILRTNLTLHDTDEEQV----------------------SHRL 61
            |.::..::..:|:::|.|.|::::.|....:.||.::.:                      :|..
Mouse   482 KEVLPDHEDEIPKTVQTVQLIEDLAREICLVEDTSQQSIPKTSTIFGLQQHHTNPSSLNRQTHST 546

  Fly    62 Q---KTVYIPNNEKGNRLA-TFVAISREEDQYIFINTLEVPPT------------ELTHALENTT 110
            .   .|:.:|:.....:.: .:..|.::|:|     |.:..||            :|.:..|..|
Mouse   547 SVSTSTLSLPSKSGSEKKSPKYKDIFKKEEQ-----TSKERPTLGPNDQHSCNFMDLNNHQELKT 606

  Fly   111 YIKWGIK 117
            ..||.||
Mouse   607 RRKWPIK 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31827NP_723923.1 Tryp_SPc 50..280 CDD:214473 18/106 (17%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.