DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31820 and CG34167

DIOPT Version :9

Sequence 1:NP_001246040.1 Gene:CG31820 / 318961 FlyBaseID:FBgn0051820 Length:62 Species:Drosophila melanogaster
Sequence 2:NP_001097165.1 Gene:CG34167 / 5740831 FlyBaseID:FBgn0085196 Length:127 Species:Drosophila melanogaster


Alignment Length:85 Identity:34/85 - (40%)
Similarity:37/85 - (43%) Gaps:26/85 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CCQGACGS---------------------VSYALAYGPVGPALPAMNYN---NCCCGPNPPCGPW 42
            ||.|:||.                     |||.|.||||||.||.|...   .||.|...|  |:
  Fly    45 CCGGSCGGSCGGSCGGSSGGCCGPPPCAVVSYRLTYGPVGPLLPCMKCTCNCGCCSGGCAP--PF 107

  Fly    43 TCPPNRCCCAGEWGCFGPFY 62
            ...||:|....|||||||.|
  Fly   108 YFVPNKCKNCWEWGCFGPLY 127



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CM1G
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019399
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.