DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31815 and CG11629

DIOPT Version :9

Sequence 1:NP_723979.1 Gene:CG31815 / 318959 FlyBaseID:FBgn0051815 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_610125.1 Gene:CG11629 / 35431 FlyBaseID:FBgn0032965 Length:463 Species:Drosophila melanogaster


Alignment Length:444 Identity:106/444 - (23%)
Similarity:178/444 - (40%) Gaps:87/444 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SKIVSIGQKQPSRSTCLSQEHCLWRQRNQMEIEQLAKLVGFQPDEIDGFLFNLSLRNYSDLLKYK 82
            |.::.:|.:.|.:|   .:|.  |...||..|..||..:...||.:..||..|:|:|:|::|...
  Fly    58 SVLMELGCRCPQKS---HKER--WFLTNQRIILALATTLNRPPDLVSDFLHTLTLQNFSEILHPA 117

  Fly    83 ECGW--NGCNVPLCYPYVCDRYMAIFDHRGNLRSPIHARSLKSLLPLLLDYLNGDSPNDRKDSPI 145
            |...  ..|.||......|:.:|.|||..||:||.:...||:.|:..:...|        |.|| 
  Fly   118 ETETLSPSCRVPFVNCGACENFMRIFDTHGNVRSRLSQDSLQLLMSAVQTVL--------KQSP- 173

  Fly   146 YEAYPDEHQAKCRSNIEQSDLEAMSSSDWISQLLGNPSESKREKTGKKTEKPQPVMRSELESELE 210
                |.|.:|   .:...|.|......|.|::..|...:|...:.|::..:......||..|.|.
  Fly   174 ----PTELRA---FDAGVSGLRGTLKRDSIARRAGIDHDSIARQNGRRRLRNSEARASENRSHLN 231

  Fly   211 SESEMEKKKRKNKTFGR--QSVFLNDELALAYAKSYDYAEYLMKTLGRHRFRDSYIGPVGDLRTT 273
            :..|..........||.  :|..|:                :|.|..:..|.||       |...
  Fly   232 TGLEQRTAGDPGYVFGSSLESAGLD----------------VMHTPEKWVFTDS-------LALE 273

  Fly   274 RTHILIRDLIARKGMNINEK--------NLRKALKKVDLE--------------WKGTTRAD--Y 314
            ||..|.:.||     .:|:|        .|..|:|.:.|:              .|....:|  |
  Fly   274 RTRRLAKLLI-----RVNDKTYLTRDTEKLITAIKDLKLDSNVTNPKKQPPRHSIKANVNSDSYY 333

  Fly   315 KREMKTAQEISRLYNVIVQTPSDEPIPWRIIGKVRENYPKVPKASKSPRKYLADQDAMVFHEPFD 379
            :|...:|.:      .::::.|......|   |...:...|||.:.: |.|..|...::.||||:
  Fly   334 ERVKASASK------AVLKSHSARGSKKR---KKASDVEPVPKRTTN-RVYYGDPLPVLLHEPFN 388

  Fly   380 HKKNWTWQRRQSKRTIRNSNYKFSTTRIKPYISRSMKQEIEPLKDEASIHSSLS 433
            .:|.|||.||..::...:...:.:...|:.|..::::|.::..|:.:|:.:.:|
  Fly   389 REKPWTWLRRHPQQMRMDEKGQVTQGNIRRYRRQTVEQMMQKAKERSSVITVIS 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31815NP_723979.1 DUF4778 35..329 CDD:292627 77/321 (24%)
CG11629NP_610125.1 DUF4778 70..333 CDD:292627 75/311 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468782
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016727
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.