DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31815 and CG2898

DIOPT Version :9

Sequence 1:NP_723979.1 Gene:CG31815 / 318959 FlyBaseID:FBgn0051815 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_572623.1 Gene:CG2898 / 31966 FlyBaseID:FBgn0030195 Length:351 Species:Drosophila melanogaster


Alignment Length:238 Identity:52/238 - (21%)
Similarity:91/238 - (38%) Gaps:41/238 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CSLTANFPWTSKIVSIGQKQPSRSTCLSQEHCLWRQRNQMEIEQLAKLVGFQPDEIDGFLFNLSL 72
            |:|..|             ..|:..|    ||.. |||:..:|..:.|......:|...||.|:.
  Fly    43 CTLCCN-------------NESKHEC----HCTC-QRNKHIVEAFSCLFRVSKFQILTTLFLLAY 89

  Fly    73 RNYSDLLKY-KECGWNGC-NVPLCYPYVCDR--YMAIFDHRGNLRSPIHARSLKSLLPLLLDYLN 133
            .....|.:: ::..|:.. ||...|..:.|.  |.::||..||...|:..::...||.|:  :|.
  Fly    90 HESRPLPRFPRDRNWSVMENVKAPYSELHDLRIYDSLFDRCGNRIDPLDQKNTYKLLRLI--FLG 152

  Fly   134 GDSPNDRKDSPIYEAYPDEHQAKCRSNIE--QSDLEAMSSSDWISQLLGNPSESKREKTGKK--- 193
            .....|::...:...|.....|.|..::.  .|.|:.:...:.:..:|.....:||..:|::   
  Fly   153 PVLVPDQQAQLLAMLYTLNAHAVCPVDLNGLLSVLQYVKLDELVCGILEQDGRAKRFHSGRQCLE 217

  Fly   194 ----------TEKPQPVM--RSELESELESESEMEKKKRKNKT 224
                      |:|...:.  |...|.....:||.:||.|:..|
  Fly   218 LCNLYQKVVATDKDAVIKKHRRRKEKSKSKDSEAQKKPRRTIT 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31815NP_723979.1 DUF4778 35..329 CDD:292627 47/211 (22%)
CG2898NP_572623.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468786
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.