Sequence 1: | NP_723828.1 | Gene: | DIP-kappa / 318958 | FlyBaseID: | FBgn0051814 | Length: | 672 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005182.1 | Gene: | CD80 / 941 | HGNCID: | 1700 | Length: | 288 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 45/205 - (21%) |
---|---|---|---|
Similarity: | 77/205 - (37%) | Gaps: | 54/205 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 303 YWTTERGDMIISDTSRAGD-----KYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVA------- 355
Fly 356 --KNSLGETDGNIKLDEMPTPTTAIISEMSLLNRSYDGKRRHRNKFDSANALPDYGVEEWRDGAQ 418
Fly 419 GNNAGNNGDNNQTPVRNPPGAFHNSAGSL-----AQHNLLAKIMLGIKTQSFGIFKRLSSSLPLA 478
Fly 479 AGQSFLWLST 488 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-kappa | NP_723828.1 | Ig | 80..172 | CDD:299845 | |
IG_like | 82..174 | CDD:214653 | |||
IG_like | 184..267 | CDD:214653 | |||
IGc2 | 191..255 | CDD:197706 | |||
IG_like | 282..368 | CDD:214653 | 21/78 (27%) | ||
Ig | 288..367 | CDD:143165 | 21/77 (27%) | ||
CD80 | NP_005182.1 | IgV_CD80 | 35..139 | CDD:319335 | 21/77 (27%) |
IgC_CD80 | 142..232 | CDD:319332 | 20/119 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |