DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and CD80

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_005182.1 Gene:CD80 / 941 HGNCID:1700 Length:288 Species:Homo sapiens


Alignment Length:205 Identity:45/205 - (21%)
Similarity:77/205 - (37%) Gaps:54/205 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 YWTTERGDMIISDTSRAGD-----KYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVA------- 355
            ||..|: .|::  |..:||     :|: ..|:...|..:.:.|.|:.|:|.|||.||.       
Human    65 YWQKEK-KMVL--TMMSGDMNIWPEYK-NRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDA 125

  Fly   356 --KNSLGETDGNIKLDEMPTPTTAIISEMSLLNRSYDGKRRHRNKFDSANALPDYGVEEWRDGAQ 418
              :..|.|...::|.| .|||:   ||:..:...:.     .|....::...|:..: .|.:..:
Human   126 FKREHLAEVTLSVKAD-FPTPS---ISDFEIPTSNI-----RRIICSTSGGFPEPHL-SWLENGE 180

  Fly   419 GNNAGNNGDNNQTPVRNPPGAFHNSAGSL-----AQHNLLAKIMLGIKTQSFGIFKRLSSSLPLA 478
            ..||     .|.|..::|....:..:..|     ..|:.:..|..|                .|.
Human   181 ELNA-----INTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYG----------------HLR 224

  Fly   479 AGQSFLWLST 488
            ..|:|.|.:|
Human   225 VNQTFNWNTT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845
IG_like 82..174 CDD:214653
IG_like 184..267 CDD:214653
IGc2 191..255 CDD:197706
IG_like 282..368 CDD:214653 21/78 (27%)
Ig 288..367 CDD:143165 21/77 (27%)
CD80NP_005182.1 IgV_CD80 35..139 CDD:319335 21/77 (27%)
IgC_CD80 142..232 CDD:319332 20/119 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.