DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Cxadr

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_006248062.1 Gene:Cxadr / 89843 RGDID:619794 Length:365 Species:Rattus norvegicus


Alignment Length:355 Identity:70/355 - (19%)
Similarity:123/355 - (34%) Gaps:83/355 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PIANVTVSVGRDALMACVV----ENLKGYKVAWV-------RVDTQTIL----SIHHNVISQ-NS 127
            |...:..:.|..|.:.|..    |:.....:.|:       :||...||    .|:.|.... ..
  Rat    25 PEQRIEKAKGETAYLPCKFTLEPEDQGPLDIEWLISPSDNQKVDQVIILYSGDKIYDNYYPDLKG 89

  Fly   128 RISLTYNDHRSW--YLHIKEVEETDRGWYMCQVNTDP-MRSRKGYLQVVVPP----IIVEGLTSN 185
            |:..|.||.:|.  .:::..::.:|.|.|.|:|...| :.:||..|.|:|.|    ..|:|  |.
  Rat    90 RVHFTSNDVKSGDASINVTNLQLSDIGTYQCKVKKAPGVANRKFLLTVLVKPSGTRCFVDG--SG 152

  Fly   186 DMVVREGQNISLVC--KARGYPEPYVMWRREDGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYL 248
            ::    |.:..|.|  |....|..|...:..|.::|  ....:..:...::.:...|..:...|.
  Rat   153 EI----GNDFKLKCEPKEGSLPLQYEWQKLSDSQKM--PTPWLAEMTSPVISVKNASSEYSGTYS 211

  Fly   249 CVASNGVPPSISKRVHLRVQFPPMLSIPNQLEGAYLGQ--------DVILECHTEAYPASINYWT 305
            |...|.|.   |.:..||:...|..:....:.||.:|.        .::..||.:          
  Rat   212 CTVQNRVG---SDQCMLRLDVVPPSNRAGTIAGAVIGTLLALVLIGAILFCCHKK---------- 263

  Fly   306 TERGDMIISDTSRAGDKYE----------------TTSTVSGYTKYMKLKIRAVGPNDFGTYRCV 354
                        |..:|||                .|||...|.......:.::.|::...|...
  Rat   264 ------------RREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKT 316

  Fly   355 AKNSLGETDGNIKLDEMPTPTTAIISEMSL 384
            ..|.:...|.. :..:.||...|.::..:|
  Rat   317 QYNQVPSEDFE-RAPQSPTLAPAKVAAPNL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 25/110 (23%)
IG_like 82..174 CDD:214653 26/110 (24%)
IG_like 184..267 CDD:214653 16/84 (19%)
IGc2 191..255 CDD:197706 12/65 (18%)
IG_like 282..368 CDD:214653 16/109 (15%)
Ig 288..367 CDD:143165 14/94 (15%)
CxadrXP_006248062.1 V-set 24..138 CDD:284989 26/112 (23%)
IG_like 27..137 CDD:214653 25/109 (23%)
IG_like 149..229 CDD:214653 18/90 (20%)
Ig 154..222 CDD:299845 14/76 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.