DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and dpr21

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:196 Identity:57/196 - (29%)
Similarity:87/196 - (44%) Gaps:18/196 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHR-SWYLHIKE 145
            |||..||....:.|.::||....|:|:|.....:|::..:..:.:.|.:..||... .|.|.||.
  Fly    60 NVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKF 124

  Fly   146 VEETDRGWYMCQVNTDPMRSRKGYLQV--VVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEP- 207
            .:..|.|.|.|||:|.|   ..||..|  ||.| |...|...::.:..|..::|.|..:..|:| 
  Fly   125 PQLRDSGIYECQVSTTP---PVGYTMVFSVVEP-ITSILGGPEIYIDLGSTVNLTCVIKHLPDPP 185

  Fly   208 -YVMWRREDGE---EMLIGGEHVNVVDGEL----LHITKVSRLHMAAYLCVASNGVPPSISKRVH 264
             .|.|...:.|   :...||..|....|::    |.|.:.|......|.|:.||....|::  ||
  Fly   186 ISVQWNHNNQEINYDSPRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANSKSVN--VH 248

  Fly   265 L 265
            :
  Fly   249 I 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 29/90 (32%)
IG_like 82..174 CDD:214653 30/94 (32%)
IG_like 184..267 CDD:214653 22/91 (24%)
IGc2 191..255 CDD:197706 19/72 (26%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
dpr21NP_001163838.2 Ig 71..149 CDD:299845 24/80 (30%)
IG_like 71..140 CDD:214653 20/68 (29%)
IG_like 162..249 CDD:214653 21/88 (24%)
IGc2 169..242 CDD:197706 19/72 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.