DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and CD276

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001019907.1 Gene:CD276 / 80381 HGNCID:19137 Length:534 Species:Homo sapiens


Alignment Length:440 Identity:94/440 - (21%)
Similarity:153/440 - (34%) Gaps:109/440 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 VTVSVGRDALMACVVENLKGYKVA-----WVRVDTQTILSIHHNVISQNSRISLTYNDHRSWY-- 140
            |...||.||.:.|......|:.:|     |...||:.:  :|.....|:.  ...|.:..:.:  
Human    38 VVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQL--VHSFAEGQDQ--GSAYANRTALFPD 98

  Fly   141 --------LHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISL 197
                    |.::.|...|.|.:.|.|:.....|....|||..|..........:..:|.|..:::
Human    99 LLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVA
APYSKPSMTLEPNKDLRPGDTVTI 163

  Fly   198 VCKA-RGYPEPYVMWRREDGEEMLIGGEHVNVVDGE------LLHITKVSRLHMAA---YLCVAS 252
            .|.: :||||..|.|  :||:.:.:.|   ||...:      |..:..:.|:.:.|   |.|:..
Human   164 TCSSYQGYPEAEVFW--QDGQGVPLTG---NVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVR 223

  Fly   253 NGVPPSISKRVHLRVQFPPMLS--------IPNQLEGAYLGQDVILECHTEAYP----ASIN-YW 304
            |   |.:.:..|..|...|..|        :|.....|.:|.|..|.|.....|    |.:| .|
Human   224 N---PVLQQDAHSSVTI
TPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIW 285

  Fly   305 -TTERGDMIISDTS--RAGDKYETTSTV------SGYTKYMKLKIRAVGPNDFGTYRC-VAKNSL 359
             .|:...::.|.|.  ..|..|...:.:      .|..   .|:::.|...|.|::.| |:....
Human   286 QLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNA---SLRLQRVRVADEGSFTCFVSIRDF 347

  Fly   360 GETDGNIKL---------------DEMPTPTTAIISEMSLLNRSYDGKRRHRNKFDSANALPDYG 409
            |....::::               |..|..|..|...      ||.|       :..|...    
Human   348 GSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCS------SYRG-------YPEAEVF---- 395

  Fly   410 VEEWRDGAQGNNAGNNGDNNQTPVRNPPGAFHNSAGSLAQHNLLAKIMLG 459
               |:|| ||.....|...:|         ..|..|....|::| :::||
Human   396 ---WQDG-QGVPLTGNVTTSQ---------MANEQGLFDVHSVL-RVVLG 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 22/103 (21%)
IG_like 82..174 CDD:214653 24/105 (23%)
IG_like 184..267 CDD:214653 22/92 (24%)
IGc2 191..255 CDD:197706 19/73 (26%)
IG_like 282..368 CDD:214653 22/100 (22%)
Ig 288..367 CDD:143165 19/93 (20%)
CD276NP_001019907.1 IG_like 37..138 CDD:214653 22/103 (21%)
Ig 43..139 CDD:299845 21/99 (21%)
Ig 148..231 CDD:299845 21/90 (23%)
IG_like 156..237 CDD:214653 23/88 (26%)
IG_like 255..356 CDD:214653 22/103 (21%)
Ig 261..357 CDD:299845 21/98 (21%)
Ig 366..449 CDD:299845 21/97 (22%)
IG_like 374..456 CDD:214653 20/89 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..534
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.