DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and BTNL8

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001035552.1 Gene:BTNL8 / 79908 HGNCID:26131 Length:500 Species:Homo sapiens


Alignment Length:168 Identity:34/168 - (20%)
Similarity:65/168 - (38%) Gaps:43/168 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PIANVTVSVGRDALMACVVE---NLKGYKVAWVRVDTQTILSIHHNVISQ--------------- 125
            |...|...||.||..:|.:.   |.:..:|.:.|....:::.::.:...|               
Human    24 PDKPVQALVGEDAAFSCFLSPKTNAEAMEVRFFRGQFSSVVHLYRDGKDQPFMQMPQYQGRTKLV 88

  Fly   126 -----NSRISLTYNDHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSN 185
                 ..|||          |.::.:...|.|.|.|::      |.:.|.|..:..:.|..|.|.
Human    89 KDSIAEGRIS----------LRLENITVLDAGLYGCRI------SSQSYYQKAIWELQVSALGSV 137

  Fly   186 DMVVREG---QNISLVCKARG-YPEPYVMWRREDGEEM 219
            .::...|   ::|.|:|::.| :|.|...|:...|:::
Human   138 PLISITGYVDRDIQLLCQSSGWFPRPTAKWKGPQGQDL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 20/114 (18%)
IG_like 82..174 CDD:214653 21/114 (18%)
IG_like 184..267 CDD:214653 10/40 (25%)
IGc2 191..255 CDD:197706 9/33 (27%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
BTNL8NP_001035552.1 IG_like 26..131 CDD:214653 21/120 (18%)
Ig_MOG_like 33..132 CDD:143190 19/114 (17%)
SPRY_PRY_C-I_1 289..460 CDD:293968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 470..500
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.