DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and VTCN1

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_011540445.2 Gene:VTCN1 / 79679 HGNCID:28873 Length:332 Species:Homo sapiens


Alignment Length:301 Identity:53/301 - (17%)
Similarity:107/301 - (35%) Gaps:100/301 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RFRLQAEFNVRQLAITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQEDSDFPRFAEPIA 81
            |.|...:.::  ::|.||...|:.:::       .....|:|:                    |.
Human    53 RIRRSRKHSI--ISIIIILAGAIALII-------GFGISGRHS--------------------IT 88

  Fly    82 NVTV----SVGRDALMACVVE---NLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHR-- 137
            ..||    ::|.|.:::|..|   .|....:.|::   :.:|.:.|..  :..:..|:..|..  
Human    89 VTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLK---EGVLGLVHEF--KEGKDELSEQDEMFR 148

  Fly   138 -------------SWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQV-------VVPPIIVEGL 182
                         :..|.:|.|:.||.|.|.|.:.|.   ..||...:       .:|.:.|:..
Human   149 GRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITS---KGKGNANLEYKTGAFSMPEVNVDYN 210

  Fly   183 TSNDMVVREGQNISLVCKA-RGYPEPYVMWRRE----------DGEEMLIGGEHVNVVDGELLHI 236
            .|::         :|.|:| |.:|:|.|:|..:          ......:..|:|.:....:|:.
Human   211 ASSE---------TLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYN 266

  Fly   237 TKVSRLHMAAYLCVASNGVPPS----------ISKRVHLRV 267
            ..::.    .|.|:..|.:..:          |.:|.||::
Human   267 VTINN----TYSCMIENDIAKATGDIKVTESEIKRRSHLQL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 24/113 (21%)
IG_like 82..174 CDD:214653 23/120 (19%)
IG_like 184..267 CDD:214653 19/103 (18%)
IGc2 191..255 CDD:197706 14/74 (19%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
VTCN1XP_011540445.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.