DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Mdga1

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001355352.1 Gene:Mdga1 / 74762 MGIID:1922012 Length:956 Species:Mus musculus


Alignment Length:651 Identity:138/651 - (21%)
Similarity:218/651 - (33%) Gaps:186/651 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VSVGRDALMACVVENLKGYKV--AWVRVDTQTILSIHHNVISQNSRISLTYNDHR----SWYLHI 143
            :.:|:|..::|.|:.:...||  .|.:         :......:.|:.:|.||..    :..|.:
Mouse   347 IQLGQDLKLSCHVDAVPQEKVNYQWFK---------NGKPARTSKRLLVTRNDPELPAVTSSLEL 402

  Fly   144 KEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMV--------------VREGQN 194
            .::..:|.|.|:|      |.|..|   ..||.:.:|...|::.|              ||||..
Mouse   403 IDLHFSDYGTYLC------MASFPG---SPVPDLSIEVNISSETVPPTISVPKGRAVVTVREGSP 458

  Fly   195 ISLVCKARGYPEPYVMWRREDGEEMLI--GGEHVNVVDGELLHITKVSRLHMAAYLCVAS--NG- 254
            ..|.|:.||.|.|.|:|.|.|.|..|:  |.......||: |.:..|||.....|.|..:  || 
Mouse   459 AELQCEVRGKPRPPVLWSRVDKEAALLPSGLALEETPDGK-LRLESVSRDMSGTYRCQTARYNGF 522

  Fly   255 -VPPSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECH-TEAYPASI--NYWTTERGDMIISD 315
             |.|. ..:|.|.|.|||.:...:|.....||:.|:|.|. ....|..|  ..|.. :|.::...
Mouse   523 NVRPR-EAQVQLTVHFPPEVEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVWRF-KGQLLPPP 585

  Fly   316 TSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLD----------E 370
            ........||..       :.:|::.|:..:..|.|.|...|.:|......::.          :
Mouse   586 PVLPAAAVETPD-------HAELRLDALTRDSSGNYECSVSNDVGSATCLFQVSAKAYSPEFYFD 643

  Fly   371 MPTPTTAIISEMSLLNRSYDGKRRHRNKFDSANALPDYGVEEWRDGAQGNNAGNNGDNNQTPVRN 435
            .|.||.   |.....|.||                    |.:|.         ....:...||.|
Mouse   644 TPNPTR---SHKLSKNYSY--------------------VLQWT---------QREPDAVDPVLN 676

  Fly   436 PPGAFHNSAGSLAQHNLLAK---------------IMLGIKT-QSFGIFKRLSSSLPLAAGQSFL 484
                :..|...|.|||.:.|               |:..::. .|:.|  ||:......||.   
Mouse   677 ----YRLSIRQLNQHNAMVKAIPVRRVEKGQLLEYILTDLRVPHSYEI--RLTPYTTFGAGD--- 732

  Fly   485 WLSTLSLVSAPSRWRMSNVENRPNSPETVVNNDTAAEC-----------WETRSHCVSESNNNNN 538
            ..|.:...:.|.        |.|:..:...:.:....|           | ||.:.:::  |...
Mouse   733 MASRIIHYTEPI--------NLPSLSDNTCHFEDEKICGYTQDLTDNFDW-TRQNALTQ--NPKR 786

  Fly   539 SRITQRPPMWARHLRIFHIAHTPCG-----ASTQYQRLCERQWQWQRLWQWQCQWKWQHQWQWPM 598
            |..|..|.         .|:.||.|     .:::.:.|.:|......|:....::          
Mouse   787 SPNTGPPT---------DISGTPEGYYMFIETSRPRELGDRARLVSPLYNASAKF---------- 832

  Fly   599 LICIVILAGCFVRWLPMLLHFIGRHIGTFSISATHRQH--LMCTFWDNRGNK--VVAKNTTPARP 659
             .|:           ....|..|:|||:.::....|..  |....|...|||  |..:...|..|
Mouse   833 -YCV-----------SFFYHMYGKHIGSLNLLVRSRNKGTLDTHAWSLSGNKGNVWQQAHVPINP 885

  Fly   660 S 660
            |
Mouse   886 S 886

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 19/94 (20%)
Ig strand B 91..95 CDD:409353 0/3 (0%)
Ig strand C 104..108 CDD:409353 2/5 (40%)
Ig strand E 139..143 CDD:409353 1/3 (33%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 1/2 (50%)
Ig 176..267 CDD:472250 34/110 (31%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653 18/88 (20%)
Ig strand B 288..292 CDD:409353 2/3 (67%)
Ig strand C 301..305 CDD:409353 1/5 (20%)
Ig strand E 330..340 CDD:409353 1/9 (11%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
Mdga1NP_001355352.1 Ig 54..115 CDD:472250
Ig strand B 56..60 CDD:409394
Ig strand C 69..73 CDD:409394
Ig strand E 91..95 CDD:409394
Ig strand F 105..110 CDD:409394
Ig_3 132..217 CDD:464046
IG_like 248..326 CDD:214653
Ig strand B 258..262 CDD:409550
Ig strand C 272..276 CDD:409550
Ig strand E 291..295 CDD:409550
Ig strand F 305..310 CDD:409550
Ig strand G 319..322 CDD:409550
Ig 347..418 CDD:472250 17/85 (20%)
Ig strand B 353..357 CDD:409353 0/3 (0%)
Ig strand C 368..372 CDD:409353 0/3 (0%)
Ig strand E 398..402 CDD:409353 1/3 (33%)
Ig strand F 412..417 CDD:409353 2/10 (20%)
Ig_3 439..515 CDD:464046 24/76 (32%)
Ig_3 538..620 CDD:464046 19/89 (21%)
MAM 754..917 CDD:99706 31/167 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 780..799 5/29 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.