DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and BTN1A1

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001723.2 Gene:BTN1A1 / 696 HGNCID:1135 Length:526 Species:Homo sapiens


Alignment Length:240 Identity:61/240 - (25%)
Similarity:89/240 - (37%) Gaps:54/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EPIANVTVSVGRDALMACVVE---NLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSW 139
            |||..|   ||.||.:.|.:.   :.:..::.|.|......:.:|.:...|.:.....|....:.
Human    36 EPILAV---VGEDAELPCRLSPNASAEHLELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATL 97

  Fly   140 Y----------LHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSN---DMVVRE 191
            .          |.|:.|..:|.|.|.|....|      |..:..:..:.|..|.|:   .|.|:|
Human    98 VQDGIAKGRVALRIRGVRVSDDGEYTCFFRED------GSYEEALVHLKVAALGSDPHISMQVQE 156

  Fly   192 GQNISLVCKARG-YPEPYVMWRREDGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGV 255
            ...|.|.|.:.| ||||.|.||...||:.....|..| .|.|.|            :...||..:
Human   157 NGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRN-PDEEGL------------FTVAASVII 208

  Fly   256 PPSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPAS 300
            ..:.:|.|...:|        |.|    |||:..:|.   :.|||
Human   209 RDTSAKNVSCYIQ--------NLL----LGQEKKVEI---SIPAS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 21/104 (20%)
IG_like 82..174 CDD:214653 20/104 (19%)
IG_like 184..267 CDD:214653 26/86 (30%)
IGc2 191..255 CDD:197706 21/64 (33%)
IG_like 282..368 CDD:214653 7/19 (37%)
Ig 288..367 CDD:143165 4/13 (31%)
BTN1A1NP_001723.2 IG_like 35..141 CDD:214653 23/113 (20%)
Ig_MOG_like 43..142 CDD:143190 18/104 (17%)
Ig 162..223 CDD:299845 22/81 (27%)
SPRY_PRY_BTN1_2 302..473 CDD:293991
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 495..526
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.