DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Kirrel3

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_006510620.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus


Alignment Length:330 Identity:83/330 - (25%)
Similarity:136/330 - (41%) Gaps:60/330 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SKGKHTRLDTQQT---AQEDSDFPRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTI 115
            :|.|..|::..|.   :|:..|         .|.|| |:...:.|.:....|: |.|::  ....
Mouse    35 AKDKFRRMNEGQVYSFSQQPQD---------QVVVS-GQPVTLLCAIPEYDGF-VLWIK--DGLA 86

  Fly   116 LSIHHNVISQNSRISLTYNDHRSWYLHIK--EVEETDRGWYMCQVNTDPMRSRKGYLQVVVP--- 175
            |.:..::.|...  .|...:|.|...|:|  ..|..|...|.||.....:|||...|.|:||   
Mouse    87 LGVGRDLSSYPQ--YLVVGNHLSGEHHLKILRAELQDDAVYECQAIQAAIRSRPARLTVLVPPDD 149

  Fly   176 PIIVEGLTSNDMVVREGQNISLVCKA-RGYPEPYVMWRREDGEEMLIGGEHVNVV--DGELLHIT 237
            |||:.|..   :.:|.|..::|.|.| ...|...::|.|:.  |::.|..:...:  ||:...| 
Mouse   150 PIILGGPV---ISLRAGDPLNLTCHADNAKPAASIIWLRKG--EVINGATYSKTLLRDGKRESI- 208

  Fly   238 KVSRLHMA--------AYLCVASN-GVPPSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECH 293
             ||.|.::        :.:|.|:| .:|......|.:.:|.||::::..:.:.......|...|.
Mouse   209 -VSTLFISPGDVENGQSIVCRATNKAIPGGKETSVTIDIQHPPLVNLSVEPQPVLEDNIVTFHCS 272

  Fly   294 TEAYPASINYWTTERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNS 358
            .:|.||...|...:||. ||.:.|  |:.|.||   ..||.:.:            ...|...|:
Mouse   273 AKANPAVTQYRWAKRGH-IIKEAS--GELYRTT---VDYTYFSE------------PVSCEVTNA 319

  Fly   359 LGETD 363
            ||.|:
Mouse   320 LGSTN 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 24/93 (26%)
IG_like 82..174 CDD:214653 25/93 (27%)
IG_like 184..267 CDD:214653 21/94 (22%)
IGc2 191..255 CDD:197706 18/75 (24%)
IG_like 282..368 CDD:214653 22/82 (27%)
Ig 288..367 CDD:143165 22/76 (29%)
Kirrel3XP_006510620.1 IG_like 54..143 CDD:214653 25/103 (24%)
Ig strand A' 56..60 CDD:409353 2/12 (17%)
Ig strand B 64..71 CDD:409353 1/6 (17%)
Ig strand C 78..82 CDD:409353 2/3 (67%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
Ig strand D 97..101 CDD:409353 0/5 (0%)
Ig strand E 104..116 CDD:409353 4/11 (36%)
Ig strand G 132..143 CDD:409353 4/10 (40%)
IgI_2_KIRREL3-like 149..246 CDD:409416 25/103 (24%)
Ig strand B 166..170 CDD:409416 1/3 (33%)
Ig strand C 180..184 CDD:409416 0/3 (0%)
Ig strand E 210..214 CDD:409416 2/3 (67%)
Ig strand F 224..229 CDD:409416 1/4 (25%)
Ig strand G 239..242 CDD:409416 0/2 (0%)
Ig <267..334 CDD:416386 22/76 (29%)
Ig strand B 267..274 CDD:409353 2/6 (33%)
Ig strand C 279..286 CDD:409353 1/6 (17%)
Ig strand C' 288..291 CDD:409353 1/3 (33%)
Ig strand D 298..302 CDD:409353 1/3 (33%)
Ig strand E 304..310 CDD:409353 2/5 (40%)
Ig strand G 321..334 CDD:409353 2/4 (50%)
Ig 335..416 CDD:416386
Ig strand A' 343..347 CDD:409353
Ig strand B 350..360 CDD:409353
Ig strand C 365..371 CDD:409353
Ig strand E 381..387 CDD:409353
IgI_5_KIRREL3 418..515 CDD:409479
Ig strand B 436..440 CDD:409479
Ig strand C 450..454 CDD:409479
Ig strand E 481..485 CDD:409479
Ig strand F 496..501 CDD:409479
Ig strand G 509..512 CDD:409479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.