DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and zgc:123297

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001032650.1 Gene:zgc:123297 / 641563 ZFINID:ZDB-GENE-051127-9 Length:318 Species:Danio rerio


Alignment Length:172 Identity:38/172 - (22%)
Similarity:66/172 - (38%) Gaps:63/172 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 VTVSVGRDALMAC-------VVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDH---- 136
            |..|||.|.::.|       ||:    .:|.|.|.|.:..| :|            .|.||    
Zfish    31 VFASVGDDVILPCSGKPNISVVD----MRVEWRRSDLKDSL-VH------------LYEDHEDRE 78

  Fly   137 ---------RSWYLH-----------IKEVEETDRGWYMCQVNTDPMRSRKGYLQVVV-----PP 176
                     |:..:|           :..|:.:|.|.|.|.:.::..: .:..:.:.|     ||
Zfish    79 TEQNESYRGRTQLIHPELQRGNASLRLSSVKVSDEGRYKCIIGSESSK-HEATVDLTVEALGWPP 142

  Fly   177 II-VEGLTSNDMVVREGQNISLVCKARG-YPEPYVMWRREDG 216
            :| ::|...:.       .:.|.|::.| ||||::.|...:|
Zfish   143 VITIDGFNPSG-------GLRLQCESEGWYPEPHLEWLNHEG 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 24/119 (20%)
IG_like 82..174 CDD:214653 24/121 (20%)
IG_like 184..267 CDD:214653 9/34 (26%)
IGc2 191..255 CDD:197706 9/27 (33%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
zgc:123297NP_001032650.1 IG_like 33..135 CDD:214653 23/119 (19%)
Ig 36..135 CDD:299845 21/116 (18%)
Ig 141..224 CDD:299845 13/44 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.