DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Pdcd1lg2

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_067371.1 Gene:Pdcd1lg2 / 58205 MGIID:1930125 Length:247 Species:Mus musculus


Alignment Length:167 Identity:43/167 - (25%)
Similarity:67/167 - (40%) Gaps:23/167 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 TVSVGRDALMACVVE-----NLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYND---HRSWY 140
            ||.||....:.|..:     .|:|.:.:..:|:..|.|        |:.|.:|....   .::.:
Mouse    31 TVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSL--------QSERATLLEEQLPLGKALF 87

  Fly   141 LHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYP 205
             ||..|:..|.|.|.|.|........| ||.|.|....:. :.:..:.|.....:.|.|:|||||
Mouse    88 -HIPSVQVRDSGQYRCLVICGAAWDYK-YLTVKV
KASYMR-IDTRILEVPGTGEVQLTCQARGYP 149

  Fly   206 EPYVMWRREDGEEMLIGGEHVNVVDGELLHITKVSRL 242
            ...|.|:   ...:.....|:...:| |..:|.|.||
Mouse   150 LAEVSWQ---NVSVPANTSHIRTPEG-LYQVTSVLRL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 24/95 (25%)
IG_like 82..174 CDD:214653 25/97 (26%)
IG_like 184..267 CDD:214653 17/59 (29%)
IGc2 191..255 CDD:197706 16/52 (31%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
Pdcd1lg2NP_067371.1 IG_like 28..119 CDD:214653 25/97 (26%)
Ig 130..192 CDD:299845 17/57 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.