DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and igsf9bb

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_068072154.1 Gene:igsf9bb / 569554 ZFINID:ZDB-GENE-091112-15 Length:1448 Species:Danio rerio


Alignment Length:570 Identity:137/570 - (24%)
Similarity:204/570 - (35%) Gaps:157/570 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 TRLDTQQTAQEDSDFPRFAEPIANVTVSVGRDALMACVVENLKG--YKVAWVRVDTQTILSIH-- 119
            ||....|.|....:.|:|....|..||.:|.|     ||..|.|  |.|.|.:........|:  
Zfish    15 TRGTAAQGAHGVREEPQFVTSRAGETVILGCD-----VVHPLNGQPYVVEWFKFGVPIPFFINFR 74

  Fly   120 ----HNVISQNSRISLTYNDHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGY----------L 170
                |.......|.||    |....|.|:.|...|:|||.|:|    :...:.|          |
Zfish    75 FYPPHVDPEYAGRASL----HGKSSLRIERVRSEDQGWYECKV----LMLEQQYHTFHNGSWVHL 131

  Fly   171 QVVVPPIIVEGLTSNDMV-VREGQNISLVCKARGYPEPYVMWRREDGEEMLIGGEHVNVVDGELL 234
            .|..||...:  |....| .:||.:|:|.|.|.|.|:|.|.|.|| |..:....:: .|.||.|.
Zfish   132 TVNAPPTFTD--TPPQYVEAKEGGSITLSCTAFGNPKPSVSWLRE-GNPVQDSTKY-KVSDGSLT 192

  Fly   235 HITKVSRLHMAAYLCVASNGVPPSISKRVH---LRVQFPPMLSIPNQLEGAYLGQDVILECHTEA 296
             :..:||....||.|.|.:    ...:.||   |.||.||.:..|.:.....:.||....|..||
Zfish   193 -LVSISREDRGAYTCRAYS----EQGEAVHTTRLLVQGPPFIVSPPENITVNISQDAFFTCQAEA 252

  Fly   297 YPASINY-WTTERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLG 360
            ||.::.| |..|..::...:..    |...:..:.|     .|.|..|.|.|.|.|.|...||||
Zfish   253 YPGNLTYTWFWEEDNVFFKNDL----KRRVSILIDG-----SLIISQVKPEDAGKYTCSPSNSLG 308

  Fly   361 E----------------------------TDGNIK--LDEMPTPTTAIISEMSLLNRSYDGKRRH 395
            .                            ..|.|:  :|..| |.|::       ....||....
Zfish   309 RPPSASAYLTVHYPARVINMPPVIYVAIGLPGYIRCPVDANP-PVTSV-------KWKKDGLPLR 365

  Fly   396 RNKFDSANALPD--YGVEEWRDGAQG-------NNAGNNGDNNQTP--VRNPP-------GAFHN 442
            ..|:...:.:.|  ..|.|..:.:.|       |:.|..|.:...|  :::||       |.:..
Zfish   366 IEKYPGWSQMEDGSIRVSEVTEDSLGTYTCVPYNSLGTMGPSPPAPLVLKDPPKFLVVPGGEYRQ 430

  Fly   443 SAG--------------------------SLAQHNLLAKIMLGIKT---QSFGIFKRLSSSLPLA 478
            .||                          |.::||:|.:..|..|:   :..|.::.::|::..:
Zfish   431 EAGRELVIPCEAEGDPFPNITWRKKVGKPSRSKHNVLPRGSLQFKSLSKEDHGEWECVASNVATS 495

  Fly   479 AGQSFLWLSTLSLVSAPSRWRMSNVENRPNSPETV---VNNDTAAECWET 525
                 :..||..||...|          |::|..|   |:..:|...|::
Zfish   496 -----ITASTHLLVIGTS----------PHAPAKVHVTVSTTSANVSWDS 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 29/109 (27%)
Ig strand B 91..95 CDD:409353 0/3 (0%)
Ig strand C 104..108 CDD:409353 1/3 (33%)
Ig strand E 139..143 CDD:409353 1/3 (33%)
Ig strand F 153..158 CDD:409353 3/4 (75%)
Ig strand G 165..168 CDD:409353 0/2 (0%)
Ig 176..267 CDD:472250 30/94 (32%)
Ig strand B 195..199 CDD:409301 2/3 (67%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 3/4 (75%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653 26/116 (22%)
Ig strand B 288..292 CDD:409353 0/3 (0%)
Ig strand C 301..305 CDD:409353 1/4 (25%)
Ig strand E 330..340 CDD:409353 2/9 (22%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 1/2 (50%)
igsf9bbXP_068072154.1 Ig 41..113 CDD:409353 24/80 (30%)
Ig strand B 41..45 CDD:409353 1/3 (33%)
Ig strand C 57..61 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 1/3 (33%)
Ig strand F 108..113 CDD:409353 3/4 (75%)
IG_like 144..223 CDD:214653 28/85 (33%)
Ig strand B 155..159 CDD:409353 2/3 (67%)
Ig strand C 168..172 CDD:409353 1/3 (33%)
Ig strand E 189..193 CDD:409353 2/4 (50%)
Ig strand F 203..208 CDD:409353 3/4 (75%)
Ig strand G 216..219 CDD:409353 2/2 (100%)
Ig 227..319 CDD:472250 26/100 (26%)
Ig strand B 244..248 CDD:409353 0/3 (0%)
Ig strand C 258..262 CDD:409353 1/3 (33%)
Ig strand E 284..288 CDD:409353 2/8 (25%)
Ig strand F 298..303 CDD:409353 2/4 (50%)
Ig strand G 312..315 CDD:409353 0/2 (0%)
Ig <343..403 CDD:472250 12/67 (18%)
Ig strand C 353..358 CDD:409353 1/11 (9%)
Ig strand E 378..382 CDD:409353 0/3 (0%)
Ig strand F 392..397 CDD:409353 0/4 (0%)
Ig 427..504 CDD:472250 12/81 (15%)
Ig strand B 436..440 CDD:409353 0/3 (0%)
Ig strand C 449..453 CDD:409353 0/3 (0%)
Ig strand E 470..474 CDD:409353 1/3 (33%)
Ig strand F 484..489 CDD:409353 0/4 (0%)
FN3 <489..>734 CDD:442628 12/57 (21%)
Ig strand G 497..500 CDD:409353 0/2 (0%)
FN3 509..604 CDD:238020 6/22 (27%)

Return to query results.
Submit another query.