DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and aebp1b

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_696022.6 Gene:aebp1b / 567630 ZFINID:ZDB-GENE-030131-8546 Length:1247 Species:Danio rerio


Alignment Length:378 Identity:84/378 - (22%)
Similarity:128/378 - (33%) Gaps:127/378 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 SWYL-----HIK-EVEETDRGWYMCQVNTDPMRSRKGYLQV-VVPPIIVEGLTSNDMVVREGQNI 195
            ||.:     |.| |:..|||..::...|   :.|.:..||| ::||.         ..:..||:.
Zfish    21 SWEVNGLTEHSKSEISHTDREQHVEDRN---VTSVEDLLQVKIIPPY---------ATIEVGQHK 73

  Fly   196 SLVCKARGYPEPYVMWRREDGEEMLIGGEHVNVV---DGELLHITKVSRLHM---AAYLCVASNG 254
            .|:||... ....:.|...:||::|.  :|.|:.   .|.:|....|...::   ..|.|||:||
Zfish    74 QLLCKVSS-DAKNINWVSPNGEKVLT--KHGNLKVHNHGSVLSSLTVLNANLNNAGIYKCVATNG 135

  Fly   255 VPPS--------ISKRV---------HLRVQFP-----PMLSIP--------------------- 276
            ...|        |.||:         ..|::.|     |..|.|                     
Zfish   136 DTESQATVKLDIILKRMRRDTDRKGREKRLKEPKPSKKPKASKPTKKPKSEKKGKGEKGGKKKGK 200

  Fly   277 -NQLEGAYLGQDVILECHT------EAY-PASINYWTTERGDMIISDTSRAGDKYETTSTVSGYT 333
             |:.|...:....:....|      |.| |....||..   |.....|:.|    .||:|.:..|
Zfish   201 KNREESTTVATTTVAPTTTVPMEYEEFYDPEPDQYWDE---DFPAETTTVA----RTTTTPTEKT 258

  Fly   334 K--------YMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDEMPTPTTAIISEMSLLNRSYD 390
            |        |.:       |:.:..|              .|:|| |||||::|:.....:..|.
Zfish   259 KDFIPDMDEYSQ-------PDSYDDY--------------WKVDE-PTPTTSVIAGRPADDDDYW 301

  Fly   391 GKRRHRNKFDSANALPDYGVEEWRDGAQGNNAGNNGDNNQTPVRNPPGAFHNS 443
            ..|    ..:....||      :.||.:.::..|:.....|.....| .|.||
Zfish   302 DAR----SVEMVENLP------FPDGKEISSTDNDWQYTTTEEPTVP-PFENS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 11/39 (28%)
IG_like 82..174 CDD:214653 13/42 (31%)
IG_like 184..267 CDD:214653 24/105 (23%)
IGc2 191..255 CDD:197706 19/69 (28%)
IG_like 282..368 CDD:214653 17/100 (17%)
Ig 288..367 CDD:143165 17/93 (18%)
aebp1bXP_696022.6 Ig 56..147 CDD:299845 26/102 (25%)
IG_like 62..145 CDD:214653 23/94 (24%)
FA58C 402..555 CDD:238014
FA58C 403..556 CDD:214572
Peptidase_M14_like 577..1036 CDD:299699
Peptidase_M14NE-CP-C_like 1040..1115 CDD:200604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.