DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and tmigd1

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001091718.3 Gene:tmigd1 / 559127 ZFINID:ZDB-GENE-080303-6 Length:249 Species:Danio rerio


Alignment Length:172 Identity:40/172 - (23%)
Similarity:75/172 - (43%) Gaps:26/172 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SVGRDALMACVVENL---KGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHIKEV- 146
            :|.....:.|:.:|.   ...::.|.|...:..|. ..|::|::|             |.::.| 
Zfish    37 AVEETVTLTCMTDNTDPSSQQELQWFRNGARVKLP-EENMMSRSS-------------LCVQPVT 87

  Fly   147 EETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEPYVMW 211
            :|.|...:.||:..|...:......|..||.:.:   :.::.|:|..:..|.|:.|..|...|:|
Zfish    88 KEDDGAVFTCQLKGDASVNSTVEFDVRYPPDLND---TTEVFVQETNDAVLSCEVRANPPVTVVW 149

  Fly   212 RREDGEEM-LIGGEHVNVVDG--ELLHITKVSR-LHMAAYLC 249
            :: |||.: |..|.:.:..:|  ..|.|.|:.| :|...|:|
Zfish   150 KK-DGEVLDLTTGSYKSTNNGITAQLTIPKLKRDVHQGLYVC 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 17/91 (19%)
Ig strand B 91..95 CDD:409353 0/3 (0%)
Ig strand C 104..108 CDD:409353 0/3 (0%)
Ig strand E 139..143 CDD:409353 1/3 (33%)
Ig strand F 153..158 CDD:409353 1/4 (25%)
Ig strand G 165..168 CDD:409353 0/2 (0%)
Ig 176..267 CDD:472250 22/78 (28%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301
IG_like 282..368 CDD:214653
Ig strand B 288..292 CDD:409353
Ig strand C 301..305 CDD:409353
Ig strand E 330..340 CDD:409353
Ig strand F 350..355 CDD:409353
Ig strand G 363..366 CDD:409353
tmigd1NP_001091718.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.