DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and iglon5

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:290 Identity:87/290 - (30%)
Similarity:142/290 - (48%) Gaps:29/290 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHIKEV 146
            |:||..|...::.|.::....:| ||  ::...||....:..|.:||:||..|::..:.:.|:.|
Zfish    35 NITVLEGESVVLRCKIDEEVTHK-AW--LNRSNILFTGTDKWSLDSRVSLENNNNSDFSIRIERV 96

  Fly   147 EETDRGWYMC--QVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEPYV 209
            ...|.|.|.|  |....| |:...||.|.||..||.  .|.|..|.||::::|.|.|.|.|||.:
Zfish    97 MVADEGPYTCSFQARNKP-RTAHVYLIV
QVPARIVN--ISQDKSVNEGEDVNLFCLAVGRPEPTI 158

  Fly   210 MWRREDGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPPSISKRVHLRVQFPPMLS 274
            .|:  |.:..|:.       :||.|.||::.|.....:.|:.:|||.|..:::|.:.|.:||:::
Zfish   159 TWK--DFKYGLLN-------EGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVKVTVNYPPIIT 214

  Fly   275 IPNQLEGAYLGQDVILECHTEAYP-ASINYWTTERGDMIISDTSRAGDKYETTSTVSGYTKYMKL 338
            ....:. |.:|:..||.|...|.| ||..::..:|..:...:|.:.  |.|.|.::..:|.    
Zfish   215 DVKNMP-AQVGKTAILRCEAMAVPTASFEWYRDDRRPVESDNTLKI--KNEKTRSLLLFTN---- 272

  Fly   339 KIRAVGPNDFGTYRCVAKNSLGETDGNIKL 368
                |....||.|.|.|.|.||.::.::.|
Zfish   273 ----VTEKHFGNYTCFASNRLGASNASMLL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 27/91 (30%)
IG_like 82..174 CDD:214653 28/93 (30%)
IG_like 184..267 CDD:214653 27/82 (33%)
IGc2 191..255 CDD:197706 20/63 (32%)
IG_like 282..368 CDD:214653 24/86 (28%)
Ig 288..367 CDD:143165 22/79 (28%)
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 27/91 (30%)
Ig 35..123 CDD:299845 27/91 (30%)
Ig 125..>183 CDD:299845 25/68 (37%)
I-set 128..207 CDD:254352 29/89 (33%)
IG_like 217..298 CDD:214653 24/91 (26%)
ig 223..296 CDD:278476 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576339
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - otm26286
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.