DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Cntn3

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_062202.1 Gene:Cntn3 / 54279 RGDID:3253 Length:1028 Species:Rattus norvegicus


Alignment Length:577 Identity:108/577 - (18%)
Similarity:184/577 - (31%) Gaps:210/577 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ANVTVSVGRDALMACVVENLKG-YKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHIK 144
            :.|:|..|:..::.|......| ...|||       .:.:.:.:.::||   .:....:.:|:|.
  Rat   130 SRVSVREGQGVVLLCGPPPHSGELSYAWV-------FNEYPSFVEEDSR---RFVSQETGHLYIA 184

  Fly   145 EVEETDRGWYMCQVNTDPMRSR------------KGYLQVVVPPIIVEGLTSNDMVVREGQNISL 197
            :||.:|.|.|.|.|.:....:|            .|.:....|.|.::  ....:...:|..:.|
  Rat   185 KVEPSDVGNYTCVVTSTVTNARVLGSPTPLVLRSDGVMGEYEPKIELQ--FPETLPAAKGSTVKL 247

  Fly   198 VCKARGYPEPYVMWRREDG-----------------------------EEMLIGGEHVNVVDGEL 233
            .|.|.|.|.|.:.|||.||                             |.:.......||..|.|
  Rat   248 ECFALGNPVPQINWRRSDGMPFPTKIKLRKFNGVLEIPNFQQEDTGSYECIAENSRGKNVARGRL 312

  Fly   234 LHITKVSRLHMAA-----------YLCVASNGVPPS-----------ISKRVHLR---------- 266
            .:..|...:.:..           :.|.||....||           :.:|:.:.          
  Rat   313 TYYAKPYWVQLLKDVETAVEDSLYWECRASGKPKPSYRWLKNGDALVLEERIQIENGALTIANLN 377

  Fly   267 ---------------------VQFPPMLSIPN-------QLEGAYLGQDVILECHTEAYPASINY 303
                                 .:...:.|.|:       ::....:|..|||:|...|.|.::::
  Rat   378 VSDSGMFQCIAENKHGLIYSSAELKVLASAPDFSRNPMKKMIQVQVGSLVILDCKPSASPRALSF 442

  Fly   304 WTTERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKL 368
            |  ::||.::.:.:|.     :.....|      |||..|...|.|.|.|:|:|..|:.:|..:|
  Rat   443 W--KKGDTVVREQARI-----SLLNDGG------LKIMNVTKADAGIYTCIAENQFGKANGTTQL 494

  Fly   369 DEMPTPTTAIISEMSLLNRSYDGKR-------RHRNKFDSANA------LPDYGVEEWRDGAQGN 420
              :.|..|.||...|.::.:. |:.       :|....|...|      |.|:.    :||:...
  Rat   495 --VVTEPTRIILAPSNMDVAV-GESIILPCQVQHDPLLDIMFAWYFNGTLTDFK----KDGSHFE 552

  Fly   421 NAGNNGDNNQTPVRNPPGAFHNSAGSLAQHNLLAK--------IMLGIKTQSFGIFKRLSSSLPL 477
            ..|.                 :|:|.|...|:..|        :..|:.:.|             
  Rat   553 KVGG-----------------SSSGDLMIRNIQLKHSGKYVCMVQTGVDSVS------------- 587

  Fly   478 AAGQSFLWLSTLSLVSAPSRWRMSNVENRPNSPETV----VNNDTAAECWE--TRSH 528
                     |...|:          |...|..||.|    :.:.||...|.  |.||
  Rat   588 ---------SAAELI----------VRGSPGPPENVKVDEITDTTAQLSWTEGTDSH 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 21/104 (20%)
Ig strand B 91..95 CDD:409353 0/3 (0%)
Ig strand C 104..108 CDD:409353 1/3 (33%)
Ig strand E 139..143 CDD:409353 1/3 (33%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 1/14 (7%)
Ig 176..267 CDD:472250 25/172 (15%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 0/3 (0%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 1/15 (7%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653 24/85 (28%)
Ig strand B 288..292 CDD:409353 3/3 (100%)
Ig strand C 301..305 CDD:409353 0/3 (0%)
Ig strand E 330..340 CDD:409353 2/9 (22%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 1/2 (50%)
Cntn3NP_062202.1 Ig 25..120 CDD:472250
Ig strand B 46..50 CDD:409353
Ig strand C 59..63 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 97..102 CDD:409353
Ig strand G 111..114 CDD:409353
Ig 129..214 CDD:472250 20/93 (22%)
Ig strand B 140..144 CDD:409353 0/3 (0%)
Ig strand C 154..158 CDD:409353 1/3 (33%)
Ig strand E 179..183 CDD:409353 1/3 (33%)
Ig strand F 193..198 CDD:409353 2/4 (50%)
Ig strand G 209..212 CDD:409353 0/2 (0%)
Ig 227..315 CDD:472250 19/89 (21%)
Ig strand B 245..249 CDD:409353 1/3 (33%)
Ig strand C 258..262 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 0/3 (0%)
Ig strand F 294..299 CDD:409353 1/4 (25%)
Ig strand G 307..310 CDD:409353 1/2 (50%)
Ig 320..403 CDD:472250 6/82 (7%)
Ig strand B 335..339 CDD:143205 0/3 (0%)
Ig strand C 348..352 CDD:143205 1/3 (33%)
Ig strand E 369..373 CDD:143205 0/3 (0%)
Ig strand F 383..388 CDD:143205 0/4 (0%)
Ig strand G 396..399 CDD:143205 0/2 (0%)
Ig 408..496 CDD:472250 26/102 (25%)
Ig strand B 427..431 CDD:409353 3/3 (100%)
Ig strand C 440..444 CDD:409353 1/5 (20%)
Ig strand E 462..466 CDD:409353 2/9 (22%)
Ig strand F 476..481 CDD:409353 2/4 (50%)
Ig strand G 489..492 CDD:409353 1/2 (50%)
Ig 498..598 CDD:472250 23/153 (15%)
Ig strand B 517..521 CDD:409353 0/3 (0%)
Ig strand C 532..536 CDD:409353 1/3 (33%)
Ig strand E 560..564 CDD:409353 2/3 (67%)
Ig strand F 574..579 CDD:409353 0/4 (0%)
FN3 579..>1028 CDD:442628 15/79 (19%)
Ig strand G 587..590 CDD:409353 2/24 (8%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 684..714
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.