DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and NTM

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001338930.1 Gene:NTM / 50863 HGNCID:17941 Length:367 Species:Homo sapiens


Alignment Length:318 Identity:105/318 - (33%)
Similarity:154/318 - (48%) Gaps:39/318 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DSDFPRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYN 134
            |:.||:..:   ||||..|..|.:.|.::| :..:|||  ::..|||...::....:.|:.|..|
Human    35 DATFPKAMD---NVTVRQGESATLRCTIDN-RVTRVAW--LNRSTILYAGNDKWCLDPRVVLLSN 93

  Fly   135 DHRSWYLHIKEVEETDRGWYMCQVNTD--PMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISL 197
            ....:.:.|:.|:..|.|.|.|.|.||  |..||. :|.|.|.|.|||  .|:|:.:.||.||||
Human    94 TQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRV-HLIVQVSPKIVE--ISSDISINEGNNISL 155

  Fly   198 VCKARGYPEPYVMWRREDGEEMLIGGEHVN------VVDGELLHITKVSRLHMAAYLCVASNGVP 256
            .|.|.|.|||.|.||            |::      |.:.|.|.|..::|.....|.|.|||.|.
Human   156 TCIATGRPEPTVTWR------------HISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVA 208

  Fly   257 PSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGD 321
            ..:.:||.:.|.:||.:| ..:..|..:||...|:|...|.|::...|..:...:|   ..:.|.
Human   209 APVVRRVKVTVNYPPYIS-EAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLI---EGKKGV 269

  Fly   322 KYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDEMPTPTTAII 379
            |.|....:|      ||....|..:|:|.|.|||.|.||.|:.:|.|.|:..||::.:
Human   270 KVENRPFLS------KLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFELNEPTSSTL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 31/93 (33%)
Ig strand B 91..95 CDD:409353 1/3 (33%)
Ig strand C 104..108 CDD:409353 2/3 (67%)
Ig strand E 139..143 CDD:409353 0/3 (0%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 2/2 (100%)
Ig 176..267 CDD:472250 35/96 (36%)
Ig strand B 195..199 CDD:409301 3/3 (100%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301 2/3 (67%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653 26/85 (31%)
Ig strand B 288..292 CDD:409353 1/3 (33%)
Ig strand C 301..305 CDD:409353 0/3 (0%)
Ig strand E 330..340 CDD:409353 3/9 (33%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
NTMNP_001338930.1 Ig 44..132 CDD:472250 30/91 (33%)
Ig strand B 53..57 CDD:409353 1/3 (33%)
Ig strand C 65..69 CDD:409353 3/5 (60%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
Ig_3 136..205 CDD:464046 30/82 (37%)
Ig 223..307 CDD:472250 28/93 (30%)
Ig strand B 239..243 CDD:409353 1/3 (33%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 3/9 (33%)
Ig strand F 292..297 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.