DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and NCAM2

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens


Alignment Length:492 Identity:104/492 - (21%)
Similarity:181/492 - (36%) Gaps:137/492 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RFRLQAEFNVRQLAITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQEDSDFPRFAEPIA 81
            |...:.|.:.|.:.:.:....|::|           |.|.                        .
Human   214 RVEARGEIDFRDIIVIVNVPPAISM-----------PQKS------------------------F 243

  Fly    82 NVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHIKEV 146
            |.|...|.:...:|.........::|.|         :..:|.:|.:..|..::..   |.::.:
Human   244 NATAERGEEMTFSCRASGSPEPAISWFR---------NGKLIEENEKYILKGSNTE---LTVRNI 296

  Fly   147 EETDRGWYMCQ-VNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEPYVM 210
            ..:|.|.|:|: .|......::.:|||.|.|.|::  ..|:.....|| ::|||.|.|.|.|.:.
Human   297 INSDGGPYVCRATNKAGEDEKQAFLQVFVQPHIIQ--LKNETTYENGQ-VTLVCDAEGEPIPEIT 358

  Fly   211 WRR-------EDGEEMLIG-----GEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPPSISKRV 263
            |:|       .:|::.|.|     |:|    ....|||..|.......|.|.|::.: ....|.:
Human   359 WKRAVDGFTFTEGDKSLDGRIEVKGQH----GSSSLHIKDVKLSDSGRYDCEAASRI-GGHQKSM 418

  Fly   264 HLRVQFPPMLSIPNQ-LEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDKYETTS 327
            :|.:::.|.. |.|| :..::.|..:.:.|..::.|.:..:|   |.|.::...       :.|:
Human   419 YLDIEYAPKF-ISNQTIYYSWEGNPINISCDVKSNPPASIHW---RRDKLVLPA-------KNTT 472

  Fly   328 TVSGYT--KYMKLKIRAVGPNDFGTYRCVAKNSLG--------------ETDGNIKLDEMPTPTT 376
            .:..|:  :.|.|:|.....||||.|.|.|.|.:|              .:...:|:.|: :.||
Human   473 NLKTYSTGRKMILEIAPTSDNDFGRYNCTATNHIGTRFQEYILALADVPSSPYGVKIIEL-SQTT 536

  Fly   377 AIISEMSLLNR--SYDGKRRHRNKFDSANALPDYGVEEWR----DGAQGNNAGNNGDNNQT---- 431
            |.:|    .|:  |:.|...|..:.|    :.:...|.|:    .|.|.....||.:.|.|    
Human   537 AKVS----FNKPDSHGGVPIHHYQVD----VKEVASEIWKIVRSHGVQTMVVLNNLEPNTTYEIR 593

  Fly   432 ---------------------PVRNP-PGAFHNSAGS 446
                                 |||.| |.:.|....|
Human   594 VAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSS 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 18/92 (20%)
Ig strand B 91..95 CDD:409353 0/3 (0%)
Ig strand C 104..108 CDD:409353 0/3 (0%)
Ig strand E 139..143 CDD:409353 1/3 (33%)
Ig strand F 153..158 CDD:409353 2/5 (40%)
Ig strand G 165..168 CDD:409353 0/2 (0%)
Ig 176..267 CDD:472250 28/102 (27%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 0/3 (0%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 1/2 (50%)
IG_like 282..368 CDD:214653 20/101 (20%)
Ig strand B 288..292 CDD:409353 0/3 (0%)
Ig strand C 301..305 CDD:409353 0/3 (0%)
Ig strand E 330..340 CDD:409353 3/11 (27%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
NCAM2XP_011527877.1 IgI_1_NCAM-2 46..138 CDD:409452
Ig strand A 46..51 CDD:409452
Ig strand A' 54..58 CDD:409452
Ig strand B 60..70 CDD:409452
Ig strand C 74..80 CDD:409452
Ig strand C' 83..85 CDD:409452
Ig strand D 91..97 CDD:409452
Ig strand E 99..107 CDD:409452
Ig strand F 114..121 CDD:409452
Ig strand G 126..137 CDD:409452
Ig 142..218 CDD:472250 1/3 (33%)
Ig strand C 170..174 CDD:409353
Ig strand E 193..197 CDD:409353
IgI_1_MuSK 234..323 CDD:409562 20/135 (15%)
Ig strand A 234..237 CDD:409562 1/2 (50%)
Ig strand A' 242..247 CDD:409562 1/28 (4%)
Ig strand B 253..260 CDD:409562 1/6 (17%)
Ig strand C 266..271 CDD:409562 1/4 (25%)
Ig strand C' 273..275 CDD:409562 0/1 (0%)
Ig strand D 282..285 CDD:409562 0/2 (0%)
Ig strand E 289..295 CDD:409562 1/8 (13%)
Ig strand F 302..309 CDD:409562 3/6 (50%)
Ig strand G 315..323 CDD:409562 1/7 (14%)
IgI_NCAM-2 325..422 CDD:143278 29/104 (28%)
Ig strand A 325..330 CDD:143278 2/4 (50%)
Ig strand A' 334..338 CDD:143278 1/3 (33%)
Ig strand B 342..350 CDD:143278 4/8 (50%)
Ig strand C 356..362 CDD:143278 1/5 (20%)
Ig strand C' 365..368 CDD:143278 0/2 (0%)
Ig strand D 378..384 CDD:143278 0/5 (0%)
Ig strand E 387..393 CDD:143278 2/5 (40%)
Ig strand F 401..409 CDD:143278 3/7 (43%)
Ig strand G 412..422 CDD:143278 2/9 (22%)
Ig_3 426..504 CDD:464046 22/88 (25%)
FN3 521..613 CDD:238020 19/100 (19%)
fn3 619..703 CDD:394996 4/12 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.