DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and NCAM1

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens


Alignment Length:450 Identity:98/450 - (21%)
Similarity:166/450 - (36%) Gaps:103/450 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GRDALMACVVENLKGYKVAWVRVDTQTIL--SIHHNVISQNSRISLTYNDHRSWYLHIKEVEETD 150
            |.||::.|.|.:.....:.|.......||  .:...|:|.|             ||.|:.:::||
Human   132 GEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNN-------------YLQIRGIKKTD 183

  Fly   151 RGWYMC--------QVNTDPMRSRKGYLQVV--VPPIIVEGLTSNDMVVREGQNISLVCKARGYP 205
            .|.|.|        ::|...       :||:  |||.|.......:.....||:::|||.|.|:|
Human   184 EGTYRCE
GRILARGEINFKD-------IQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFP 241

  Fly   206 EPYVMWRREDGEEMLIGGEHVNVV---DGELLHITKVSRLHMAAYLCVASNGVPPSISKRVHLRV 267
            ||.:.|.: |||::....:....:   |...|.|.||.:...|.|:|:|.|..... ...:||:|
Human   242 EPTMSWTK-DGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQ-DATIHLKV 304

  Fly   268 QFPPMLSIPNQLEGAYLGQDVILECHTEAYP-ASINYWTTERGDMIISDTSRAG----------- 320
            ...|.::.........|.:.|.|.|.....| .||.:.|:.|.   ||...:|.           
Human   305 FAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRN---ISSEEKASWTRPEKQEVHA 366

  Fly   321 -------------------DKYETTS---TVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETD 363
                               ..:||..   .|..:.:...|.::::...|.|.|.|.|.|::|:..
Human   367 PWNWQVGRQKGQAGSAGFPGSHETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDS 431

  Fly   364 GNIKLD-----EMPTPTTAIISEMSLLNRSYDGKRRHRNKFDSANALPDYGVEEWRDG--AQGNN 421
            .::.|:     ::..|......|.:.:|.:.:           ..|.|...:..:|||  ...:|
Human   432 QSMYLEVQYAPKLQGPVAVYTWEGNQVNITCE-----------VFAYPSATISWFRDGQLLPSSN 485

  Fly   422 AGNNGDNNQTPVRNPPGAFH-----NSAGSLAQHNLLAKIMLGIKTQSFGIFKRLSSSLP 476
            ..|      ..:.|.|.|.:     :|......:|..|...:|.::..|.:.:..:.|.|
Human   486 YSN------IKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSP 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 20/93 (22%)
IG_like 82..174 CDD:214653 22/97 (23%)
IG_like 184..267 CDD:214653 26/85 (31%)
IGc2 191..255 CDD:197706 24/66 (36%)
IG_like 282..368 CDD:214653 23/119 (19%)
Ig 288..367 CDD:143165 22/112 (20%)
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652 18/70 (26%)
Ig 211..307 CDD:325142 30/97 (31%)
Ig 306..438 CDD:325142 25/134 (19%)
Ig_3 447..519 CDD:316449 16/88 (18%)
FN3 534..631 CDD:238020 1/5 (20%)
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.