DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and tutl

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:400 Identity:94/400 - (23%)
Similarity:155/400 - (38%) Gaps:77/400 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RRRFRLQAEFNVRQLAITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQEDSDFPRFAEP 79
            |||.|.:||      ..:|..........|.|||:..:    :...:.......:::......|.
  Fly    80 RRRSRRRAE------GSSICVPIRRGQGSTPTPTIQVL----QFVLVSLLALLAKNAQAHNIPED 134

  Fly    80 IANVTVSVGRDALMACVVENLKGYKVAWV-----RV-DTQTILSIH--------HNVISQNSRIS 130
            ..::|..:|...:..|.||....:.|.:|     :| :|.:.|.|:        |.......|:|
  Fly   135 AVHITAILGEGVIFNCHVEFPNDHPVPYVLQWDKKVSETGSDLPIYIWYESYPEHIEEGYKGRVS 199

  Fly   131 LTYND--HRSWYLHIKEVEETDRGWYMCQV---NTDPMRSRKG---YLQVVVPPIIVEGLTSNDM 187
            ....|  ..|..|::..:.|:|:|||.|:|   |.||.:.:.|   :|.|..||..  .:|..|:
  Fly   200 RVSQDSPFGSASLNLTNIRESDQGWYECKVVFLNRDPKQHKNGTWFHLDVHAPPRF--SVTPEDI 262

  Fly   188 V-VREGQNISLVCKARGYPEPYVMWRREDGEEMLIGGEHVNVV----------DGELLHITKVSR 241
            : |..|.:|.|.|:|.|.|.|.::|.::           .|.|          ||..|.|:.:..
  Fly   263 IYVNLGDSIILNCQADGTPTPEILWYKD-----------ANPVDPSPTVGIFNDGTELRISTIRH 316

  Fly   242 LHMAAYLCVASNGVPPSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINY-WT 305
            ..:..|.|:|.|| ...:|....:.:....::.:|...:....|:.||..|..:|.|.::.. |.
  Fly   317 EDIGEYTCIARNG-EGQVSHTARVIIAGGAVIMVPPTNQTKLEGEKVIFSCEAKAMPGNVTVRWY 380

  Fly   306 TERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDE 370
            .|...:      |.....||..|:   .|...|.|..:.|:|.|.|.|...|.:|:         
  Fly   381 REGSPV------REVAALETRVTI---RKDGSLIINPIKPDDSGQYLCEVTNGIGD--------- 427

  Fly   371 MPTPTTAIIS 380
             |...:|.:|
  Fly   428 -PQSASAYLS 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 29/113 (26%)
IG_like 82..174 CDD:214653 30/113 (27%)
IG_like 184..267 CDD:214653 23/93 (25%)
IGc2 191..255 CDD:197706 19/73 (26%)
IG_like 282..368 CDD:214653 22/86 (26%)
Ig 288..367 CDD:143165 21/79 (27%)
tutlNP_001303307.1 V-set 137..250 CDD:284989 29/112 (26%)
IG_like 137..229 CDD:214653 23/91 (25%)
I-set 253..341 CDD:254352 25/101 (25%)
IGc2 268..331 CDD:197706 20/74 (27%)
I-set 346..437 CDD:254352 25/109 (23%)
Ig 349..437 CDD:299845 25/106 (24%)
Ig 459..530 CDD:299845
IG_like 549..628 CDD:214653
IGc2 551..617 CDD:197706
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.