DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and robo2

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001259868.1 Gene:robo2 / 44522 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster


Alignment Length:581 Identity:142/581 - (24%)
Similarity:215/581 - (37%) Gaps:149/581 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GPHRLPRP----------HTRRR-------FRLQAEFNVRQLAITIIATAAVTMLMTATPTLAEI 52
            |.||:..|          |:||.       ...:.||.|.:                        
  Fly   136 GSHRIMLPAGGLFFLKVIHSRRESDAGTYWCEAKNEFGVAR------------------------ 176

  Fly    53 PSKGKHTRLDTQQTAQEDSDFPRFAEPIANVTVSVGRDALMACVVENLKGY---KVAWVRVDTQT 114
                  :|..|.|.|....:|.  .|| ||..|:.|..|||.|...  :|.   :::| |.:.||
  Fly   177 ------SRNATLQVAFLRDEFR--LEP-ANTRVAQGEVALMECGAP--RGSPEPQISW-RKNGQT 229

  Fly   115 ILSIHHNVISQNSRISLTYNDHRSWYLHIKEVEETDRGWYMCQVN--TDPMRSRKGYLQVVVPPI 177
            :     |::. |.||.:....:    |.|:|..::|.|.|.|.|.  .....|...:|:|.|.|.
  Fly   230 L-----NLVG-NKRIRIVDGGN----LAIQEARQSDDGRYQCVVKNVVGTRESATAFLKVHVRPF 284

  Fly   178 IVEGLTSNDMVVREGQNISLVCKARGYPEPYVMWRR-EDGEEMLIGGEHVNVVDGELLHITKVSR 241
            ::.|..:...||  |.::...|:..|.|.|.|:||| ..|..|.:  ..|:|::...|.:..|:.
  Fly   285 LIRGPQNQTAVV--GSSVVFQCRIGGDPLPDVLWRRTASGGNMPL--RRVHVLEDRSLKLDDVTL 345

  Fly   242 LHMAAYLCVASNGVPPSISKRVHLRVQFPPMLSI--PNQLEGAYLGQDVILECHTEAYPASINYW 304
            ..|..|.|.|.|.| ..|:....|.|..||...|  .|||  ..:|.:|:.||....:|....||
  Fly   346 EDMGEYTCEADNAV-GGITATGILTVHAPPKFVIRPKNQL--VEIGDEVLFECQANGHPRPTLYW 407

  Fly   305 TTERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFG-TYRCVAKNSLGETDGN--I 366
            :.|....::....|.| :.|.|.|..|.:   .|.|......|.| ...|.|.|::|.....  :
  Fly   408 SVEGNSSLLLPGYRDG-RMEVTLTPEGRS---VLSIARFAREDSGKVVTCNALNAVGSVSSRTVV 468

  Fly   367 KLD---EMPTPTTAIISEMSLLNRSYDGKRRHRNKFDSANALP--DYG-----VEEWRDG----A 417
            .:|   |:|.|    |.|...:|::...|        |...||  ..|     |..:.||    .
  Fly   469 SVDTQFELPPP----IIEQGPVNQTLPVK--------SIVVLPCRTLGTPVPQVSWYLDGIPIDV 521

  Fly   418 QGNNAGNNGDNNQTPVRNPPGAFHNSAGSLAQHNLLAKIMLGIKTQSFGIFKRLSSSLPLAAGQS 482
            |.:...|..|                ||:|...:|.       :.:..|::..::|:   ..|:|
  Fly   522 QEHERRNLSD----------------AGALTISDLQ-------RHEDEGLYTCVASN---RNGKS 560

  Fly   483 ----FLWLST-----LSLVSAPSRWRMSNVENRPNSPETVVNNDTAAECWETRSHCVSESN 534
                :|.|.|     :....||   .:|.....|..|:.|...:.:.....|||:.|..|:
  Fly   561 SWSGYLRLDTPTNPNIKFFRAP---ELSTYPGPPGKPQMVEKGENSVTLSWTRSNKVGGSS 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 27/96 (28%)
Ig strand B 91..95 CDD:409353 3/3 (100%)
Ig strand C 104..108 CDD:409353 0/3 (0%)
Ig strand E 139..143 CDD:409353 1/3 (33%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 1/2 (50%)
Ig 176..267 CDD:472250 27/91 (30%)
Ig strand B 195..199 CDD:409301 0/3 (0%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653 22/88 (25%)
Ig strand B 288..292 CDD:409353 1/3 (33%)
Ig strand C 301..305 CDD:409353 1/3 (33%)
Ig strand E 330..340 CDD:409353 2/9 (22%)
Ig strand F 350..355 CDD:409353 1/4 (25%)
Ig strand G 363..366 CDD:409353 0/4 (0%)
robo2NP_001259868.1 IgC_1_Robo 91..185 CDD:409490 13/78 (17%)
Ig strand A 91..95 CDD:409490
Ig strand A' 98..103 CDD:409490
Ig strand B 107..115 CDD:409490
Ig strand C 121..126 CDD:409490
Ig strand C' 129..131 CDD:409490
Ig strand D 139..142 CDD:409490 1/2 (50%)
Ig strand E 145..151 CDD:409490 0/5 (0%)
Ig strand F 162..170 CDD:409490 0/7 (0%)
Ig strand G 173..185 CDD:409490 4/41 (10%)
IgI_2_Robo 192..279 CDD:409389 29/102 (28%)
Ig strand A 192..195 CDD:409389 0/4 (0%)
Ig strand A' 197..201 CDD:409389 1/3 (33%)
Ig strand B 205..212 CDD:409389 4/6 (67%)
Ig strand C 220..225 CDD:409389 1/5 (20%)
Ig strand C' 227..230 CDD:409389 1/2 (50%)
Ig strand D 237..241 CDD:409389 2/3 (67%)
Ig strand E 244..250 CDD:409389 2/9 (22%)
Ig strand F 257..265 CDD:409389 4/7 (57%)
Ig strand G 268..279 CDD:409389 2/10 (20%)
Ig 286..370 CDD:472250 26/88 (30%)
Ig strand B 300..304 CDD:409353 0/3 (0%)
Ig strand C 313..317 CDD:409353 1/3 (33%)
Ig strand E 336..340 CDD:409353 1/3 (33%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
Ig_3 373..457 CDD:464046 26/89 (29%)
Ig 480..566 CDD:472250 22/119 (18%)
Ig strand B 496..500 CDD:409353 1/3 (33%)
Ig strand C 509..513 CDD:409353 1/3 (33%)
Ig strand E 533..537 CDD:409353 2/3 (67%)
Ig strand F 548..553 CDD:409353 0/4 (0%)
Ig strand G 561..564 CDD:409353 0/2 (0%)
COG3979 586..>800 CDD:443178 8/33 (24%)
FN3 588..681 CDD:238020 8/31 (26%)
fn3 864..952 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.