DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and dpr17

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:208 Identity:66/208 - (31%)
Similarity:98/208 - (47%) Gaps:27/208 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTY-NDH-RSWYL 141
            |:.|:|..:|..|.|.|.:..|....|:|||:....|:|:.......:.|....| .|| .:|.|
  Fly   411 PVLNITAQMGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSL 475

  Fly   142 HIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPE 206
            .||.||.:|.|||.||:.|:|..|.|.:||:|.|.  .|.:......|:.|..::|.|..||..:
  Fly   476 QIKYVEPSDAGWYECQMATEPKLSAKVHLQIVKPK--TELIGDQSRFVKAGSKVALHCIVRGTLD 538

  Fly   207 P--YVMWRR-----EDGEEM----------LIG--GEHVNVVDGELLHITKVSRLHMAAYLCVAS 252
            |  |::|.|     .|.:|.          :.|  |::.|.: |.|: |..|.:.....|.|..|
  Fly   539 PPKYIIWFRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTI-GSLI-IPLVRKEDSGNYTCQPS 601

  Fly   253 NGVPPSISKRVHL 265
            |.|  |:|..:|:
  Fly   602 NSV--SVSVDLHV 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 34/93 (37%)
IG_like 82..174 CDD:214653 35/93 (38%)
IG_like 184..267 CDD:214653 27/101 (27%)
IGc2 191..255 CDD:197706 22/82 (27%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 27/76 (36%)
Ig 415..507 CDD:299845 34/91 (37%)
IG_like 521..612 CDD:214653 26/94 (28%)
IGc2 524..605 CDD:197706 23/84 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12107
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.