Sequence 1: | NP_723828.1 | Gene: | DIP-kappa / 318958 | FlyBaseID: | FBgn0051814 | Length: | 672 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650080.3 | Gene: | dpr5 / 41381 | FlyBaseID: | FBgn0037908 | Length: | 336 | Species: | Drosophila melanogaster |
Alignment Length: | 213 | Identity: | 56/213 - (26%) |
---|---|---|---|
Similarity: | 90/213 - (42%) | Gaps: | 27/213 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 83 VTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHR-SWYLHIKEV 146
Fly 147 EETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEPY--V 209
Fly 210 MWRRE-----DGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPPSISKRVHL---- 265
Fly 266 -----------RVQFPPM 272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-kappa | NP_723828.1 | Ig | 80..172 | CDD:299845 | 28/89 (31%) |
IG_like | 82..174 | CDD:214653 | 29/91 (32%) | ||
IG_like | 184..267 | CDD:214653 | 22/104 (21%) | ||
IGc2 | 191..255 | CDD:197706 | 19/70 (27%) | ||
IG_like | 282..368 | CDD:214653 | |||
Ig | 288..367 | CDD:143165 | |||
dpr5 | NP_650080.3 | V-set | 95..191 | CDD:284989 | 28/90 (31%) |
IG_like | 98..179 | CDD:214653 | 24/78 (31%) | ||
IG_like | 206..278 | CDD:214653 | 19/71 (27%) | ||
Ig | 211..278 | CDD:143165 | 18/66 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |