DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Ama

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:323 Identity:91/323 - (28%)
Similarity:146/323 - (45%) Gaps:37/323 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVR----VDTQTILSIHHNVIS-QNSRISLTY 133
            |..::...:|..|||......|.||.:....|:|.:    .||.:::....|::| .:.|.::|.
  Fly    33 PVISQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSLPDQRYNVTV 97

  Fly   134 ND-----HRSWYLHIKEVEETDRGWYMCQ--VNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVRE 191
            .:     ...:...|:.:|.:|.|.|.||  |:.....::|..||:..||:|.|. |....:|.|
  Fly    98 TEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTPPVIAEN-TPKSTLVTE 161

  Fly   192 GQNISLVCKARGYPEPYVMWRREDGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVP 256
            |||:.|.|.|.|:|:|.:.|.||....|..||   :::....|.|..|.|:....|.|:|.||..
  Fly   162 GQNLELTCHANGFPKPTISWAREHNAVMPAGG---HLLAEPTLRIRSVHRMDRGGYYCIAQNGEG 223

  Fly   257 PSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINYW-------TTERGDMIIS 314
            ....:.:.:.|:|.|.:::........:.....|||..:.|||....|       .:.|...:.:
  Fly   224 QPDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHKNGVPLQSSRHHEVAN 288

  Fly   315 DTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDE--MPTPT 375
            ..|.:|    ||::|        |:|.:||..|||.|.|.|.|.||..|..:.|.:  :|.|:
  Fly   289 TASSSG----TTTSV--------LRIDSVGEEDFGDYYCNATNKLGHADARLHLFQTVIPVPS 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 26/103 (25%)
Ig strand B 91..95 CDD:409353 0/3 (0%)
Ig strand C 104..108 CDD:409353 1/3 (33%)
Ig strand E 139..143 CDD:409353 0/3 (0%)
Ig strand F 153..158 CDD:409353 3/6 (50%)
Ig strand G 165..168 CDD:409353 0/2 (0%)
Ig 176..267 CDD:472250 30/90 (33%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 0/3 (0%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653 27/92 (29%)
Ig strand B 288..292 CDD:409353 1/3 (33%)
Ig strand C 301..305 CDD:409353 1/10 (10%)
Ig strand E 330..340 CDD:409353 1/9 (11%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 1/2 (50%)
AmaNP_731114.2 I-set 33..143 CDD:400151 26/109 (24%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..68 CDD:409353 2/4 (50%)
Ig strand E 101..112 CDD:409353 0/10 (0%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig_3 146..220 CDD:464046 29/77 (38%)
I-set 254..330 CDD:400151 27/87 (31%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 298..302 CDD:409353 2/11 (18%)
Ig strand F 312..317 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.