DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and dpr16

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:295 Identity:73/295 - (24%)
Similarity:108/295 - (36%) Gaps:81/295 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PTLAEIPSK-GKHTRL---DTQQTAQ----------EDSDFPR--FAEPIANVTVSVGRDALMAC 95
            |:.:.:||| .:.:||   |::|.||          |....||  .:.|..|.||..|:.|.:.|
  Fly   156 PSGSPMPSKPNEQSRLHAYDSEQKAQQLRREKELAKERELLPRRQLSLPPLNATVQAGQHAYLPC 220

  Fly    96 VVENLKGYKVAWVRVDTQTILSIHHNVISQNSR------------------ISLT---------- 132
            .:....|..::|||:..:.|:::.|.....::|                  :|.|          
  Fly   221 KLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTLTTLVSGGALSTTATPVAALGNS 285

  Fly   133 ------------YNDHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSN 185
                        .:...||.|.||.|...|.|||.||:.|:|..|.|..|.|:.|.  .|.:...
  Fly   286 FAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPKMSAKVQLFVITPR--TELIGDR 348

  Fly   186 DMVVREGQNISLVCKARGYPE--PYVMWRREDG-------------------EEMLIGG-EHVNV 228
            ...|:.|..:.|.|..||..|  .|:.|.|.|.                   :..:.|. ||...
  Fly   349 QRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRN 413

  Fly   229 VDGELLHITKVSRLHMAAYLCVASNGVPPSISKRV 263
            ..|.|: |..|.::|...|.|...|....|:...|
  Fly   414 TIGSLV-IPLVRKIHSGNYTCEPENSAAASMQLHV 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 33/131 (25%)
Ig strand B 91..95 CDD:409353 1/3 (33%)
Ig strand C 104..108 CDD:409353 0/3 (0%)
Ig strand E 139..143 CDD:409353 2/3 (67%)
Ig strand F 153..158 CDD:409353 3/4 (75%)
Ig strand G 165..168 CDD:409353 1/2 (50%)
Ig 176..267 CDD:472250 25/110 (23%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653
Ig strand B 288..292 CDD:409353
Ig strand C 301..305 CDD:409353
Ig strand E 330..340 CDD:409353
Ig strand F 350..355 CDD:409353
Ig strand G 363..366 CDD:409353
dpr16NP_001287169.1 IG_like 352..447 CDD:214653 23/95 (24%)
Ig strand B 358..362 CDD:409353 1/3 (33%)
Ig strand C 373..377 CDD:409353 1/3 (33%)
Ig strand E 416..420 CDD:409353 2/4 (50%)
Ig strand F 430..435 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.