DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Btnl7

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_017457195.1 Gene:Btnl7 / 406159 RGDID:1303124 Length:547 Species:Rattus norvegicus


Alignment Length:336 Identity:69/336 - (20%)
Similarity:124/336 - (36%) Gaps:105/336 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LMTATPTLAEIPSKGKHTRLDTQQTAQEDSDFPRFAEPIANVTVSVGRDALMAC------VVENL 100
            |:..|..|..:.:||                |..|. |...|..:.||:|::.|      .|||:
  Rat    16 LLVLTQLLCWVTTKG----------------FWVFG-PSDPVVAAPGREAILPCSVFPAMSVENM 63

  Fly   101 KGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSW--------------YLHIKEVEETDR 151
            :  ::.|.|......:.::.:...|.....:.|    ||              .:.|:.|:|:|.
  Rat    64 E--ELRWFRNRFSQAVFVYRDQEEQKEEQMIEY----SWRTSLVKDQFHEGKAAVRIQNVQESDS 122

  Fly   152 GWYMCQVNTDPMRSRKGYLQV------VVPPIIVEGLTSNDMVVREGQNISLVCKARG-YPEPYV 209
            |.|:|.......| .:..|::      .||.:.::|        .|...:.:||...| ||||.|
  Rat   123 GIYVCHFKHGHFR-EEAILELKVAAMGSVPEVYIKG--------PEDGGVCVVCMTSGWYPEPQV 178

  Fly   210 MWRREDGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGV--------PPSISKRVHLR 266
            .||...||::....|.:: .|.|.|..|:.|       |.|..:.|        .|.:.:...:.
  Rat   179 HWRDSRGEDLPASSETLH-EDAEGLFSTENS-------LVVRDSSVRNVTCSTFNPILGQEKAMA 235

  Fly   267 VQFP-PMLSIPNQLEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDKYETTSTVS 330
            :..| |.....:..:.|::   |||               |..|.:::.           |.::.
  Rat   236 IVIPEPFFPQASPWKTAFV---VIL---------------TMMGLLVLG-----------TISLF 271

  Fly   331 GYTKYMKLKIR 341
            |:.::::||::
  Rat   272 GWERFVRLKLQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 23/111 (21%)
IG_like 82..174 CDD:214653 23/117 (20%)
IG_like 184..267 CDD:214653 23/91 (25%)
IGc2 191..255 CDD:197706 21/64 (33%)
IG_like 282..368 CDD:214653 10/60 (17%)
Ig 288..367 CDD:143165 9/54 (17%)
Btnl7XP_017457195.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.