DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and LSAMP

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:313 Identity:105/313 - (33%)
Similarity:149/313 - (47%) Gaps:42/313 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DFPRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDH 136
            ||.|..:   |:||..|..|::.||||: |..||||  ::...|:...|:..|.:.|:.|.....
Human    33 DFNRGTD---NITVRQGDTAILRCVVED-KNSKVAW--LNRSGIIFAGHDKWSLDPRVELEKRHS 91

  Fly   137 RSWYLHIKEVEETDRGWYMCQVNT--DPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVC 199
            ..:.|.|::|:..|.|.|.|.|.|  :|..|:. ||.|.|||.|..  .|:|:.|.||.|::|||
Human    92 LEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQV-YLIVQVPPKISN--ISSDVTVNEGSNVTLVC 153

  Fly   200 KARGYPEPYVMWR------RE-DGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPP 257
            .|.|.|||.:.||      || :|||             |.|.|..::|.....|.|.|:|.|..
Human   154 MANGRPEPVITWRHLTPTGREFEGEE-------------EYLEILGITREQSGKYECKAANEVSS 205

  Fly   258 SISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDK 322
            :..|:|.:.|.:||.::.....| |..|:...|:|...|.||....|  .|.|..|:  |..|.:
Human   206 ADVKQVKVTVNYPPTITESKSNE-ATTGRQASLKCEASAVPAPDFEW--YRDDTRIN--SANGLE 265

  Fly   323 YETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDEMPTPT 375
            .::|...|..|      :..|....:|.|.|||.|.||.|:.::.|.:...||
Human   266 IKSTEGQSSLT------VTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPT 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 32/93 (34%)
IG_like 82..174 CDD:214653 33/93 (35%)
IG_like 184..267 CDD:214653 32/89 (36%)
IGc2 191..255 CDD:197706 26/70 (37%)
IG_like 282..368 CDD:214653 26/85 (31%)
Ig 288..367 CDD:143165 24/78 (31%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 32/96 (33%)
Ig 132..215 CDD:386229 34/97 (35%)
Ig_3 219..294 CDD:372822 24/85 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143415
Domainoid 1 1.000 45 1.000 Domainoid score I12195
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3058
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.