DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and dpr10

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:324 Identity:78/324 - (24%)
Similarity:117/324 - (36%) Gaps:91/324 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SKGKHTRLDTQQTAQEDSDFP---RFAEPI------ANVTVSVGRDALMACVVENLKGYKVAWVR 109
            |...|...:.:.|....|.:|   ::.||.      .|:|..||:.|.:.|.|::|....|||:|
  Fly    25 SNNNHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIR 89

  Fly   110 VDTQTILSIHHNVISQNSRISLTYN-DHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVV 173
            .....||::.....:.:.|...:|: |...|.|.||..::.|.|.|.||::|.|:||....|.:|
  Fly    90 HRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIV 154

  Fly   174 ----------------------------------------------VPPIIVEGLTSNDMVVREG 192
                                                          ||...:.|  ..|:.|.:|
  Fly   155 DLIDAETSDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAVPTATILG--GPDLYVDKG 217

  Fly   193 QNISLVCKARGYPEP--YVMWRRED---GEEMLIGGEHVNVVDGE----LLHITKVSRLHMAAYL 248
            ..|:|.|..:..|||  ::.|..:|   .||...|......:..|    :|.|.....||...|.
  Fly   218 STINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYS 282

  Fly   249 CVASNGVPPSISKRVH-LRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINY--WTTERG 309
            |..||....||  ||| |:.:.|..:                   .|.|.||::..  |:...|
  Fly   283 CYPSNTEIASI--RVHVLQGERPEAM-------------------QTNAAPAAVALACWSCHFG 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 31/98 (32%)
IG_like 82..174 CDD:214653 32/138 (23%)
IG_like 184..267 CDD:214653 29/92 (32%)
IGc2 191..255 CDD:197706 21/72 (29%)
IG_like 282..368 CDD:214653 6/30 (20%)
Ig 288..367 CDD:143165 6/24 (25%)
dpr10NP_729591.1 Ig 63..143 CDD:299845 26/79 (33%)
IG_like 210..297 CDD:214653 27/88 (31%)
IGc2 217..287 CDD:197706 19/69 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.