DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and robo1

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster


Alignment Length:324 Identity:86/324 - (26%)
Similarity:127/324 - (39%) Gaps:52/324 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRS 138
            |.|.:...:..:..|:.|...|.|......||.|.:.:        .|:....:||   .:|.:|
  Fly   255 PYFMKEPKDQVMLYGQTATFHCSVGGDPPPKVLWKKEE--------GNIPVSRARI---LHDEKS 308

  Fly   139 WYLHIKEVEETDRGWYMCQV-NTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKAR 202
              |.|..:..||.|.|:|:. |.....|.:..|.|..||...: ..||..|...|. :.|.|.|.
  Fly   309 --LEISNITPTDEGTYVCEAHNNVGQISARASLIVHAPPNFTK-RPSNKKVGLNGV-VQLPCMAS 369

  Fly   203 GYPEPYVMWRREDGEEMLI-----GGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPPSISKR 262
            |.|.|.|.|.:|....::.     |.:|| ..|| .|.||.|.:.....|:|.|.: |..|.:.|
  Fly   370 GNPPPSVFWTKEGVSTLMFPNSSHGRQHV-AADG-TLQITDVRQEDEGYYVCSAFS-VVDSSTVR 431

  Fly   263 VHLRVQF-----PPMLSIPNQLEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDK 322
            |.|:|..     ||::.|....:....|....|.|.....|:....|..: |..:     :||::
  Fly   432 VFLQVSSLDERPPPIIQIGPANQTLPKGSVATLPCRATGNPSPRIKWFHD-GHAV-----QAGNR 490

  Fly   323 YETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETD----------GNIKLDEMPTPTT 376
            |   |.:.|    ..|::..:..:|.|||.|.|....|||.          |:..|.....|:|
  Fly   491 Y---SIIQG----SSLRVDDLQLSDSGTYTCTASGERGETSWAATLTVEKPGSTSLHRAADPST 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 23/92 (25%)
Ig strand B 91..95 CDD:409353 1/3 (33%)
Ig strand C 104..108 CDD:409353 2/3 (67%)
Ig strand E 139..143 CDD:409353 1/3 (33%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 1/2 (50%)
Ig 176..267 CDD:472250 31/95 (33%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653 22/95 (23%)
Ig strand B 288..292 CDD:409353 1/3 (33%)
Ig strand C 301..305 CDD:409353 0/3 (0%)
Ig strand E 330..340 CDD:409353 2/9 (22%)
Ig strand F 350..355 CDD:409353 3/4 (75%)
Ig strand G 363..366 CDD:409353 1/12 (8%)
robo1NP_476899.1 Ig 56..151 CDD:472250
Ig strand B 73..77 CDD:409353
Ig strand C 86..90 CDD:409353
Ig strand E 111..115 CDD:409353
Ig strand F 129..134 CDD:409353
Ig strand G 143..146 CDD:409353
IgI_2_Robo 158..251 CDD:409389
Ig strand A 158..161 CDD:409389
Ig strand A' 163..167 CDD:409389
Ig strand B 171..178 CDD:409389
Ig strand C 186..191 CDD:409389
Ig strand C' 193..196 CDD:409389
Ig strand D 209..213 CDD:409389
Ig strand E 216..222 CDD:409389
Ig strand F 229..237 CDD:409389
Ig strand G 240..251 CDD:409389
IgI_3_Robo 258..341 CDD:409390 22/95 (23%)
Ig strand A 258..261 CDD:409390 0/2 (0%)
Ig strand A' 263..267 CDD:409390 0/3 (0%)
Ig strand B 270..279 CDD:409390 2/8 (25%)
Ig strand C 285..290 CDD:409390 3/4 (75%)
Ig strand C' 293..296 CDD:409390 1/2 (50%)
Ig strand D 299..304 CDD:409390 2/7 (29%)
Ig strand E 305..313 CDD:409390 4/9 (44%)
Ig strand F 320..328 CDD:409390 3/7 (43%)
Ig strand G 331..341 CDD:409390 2/9 (22%)
Ig 346..437 CDD:472250 30/95 (32%)
Ig strand B 362..366 CDD:409353 1/3 (33%)
Ig strand C 375..379 CDD:409353 1/3 (33%)
Ig strand E 402..406 CDD:409353 2/4 (50%)
Ig strand F 416..421 CDD:409353 2/4 (50%)
Ig strand G 429..432 CDD:409353 0/2 (0%)
Ig 446..531 CDD:472250 22/97 (23%)
Ig strand B 462..466 CDD:409544 1/3 (33%)
Ig strand C 475..479 CDD:409544 0/3 (0%)
Ig strand E 497..501 CDD:409544 1/3 (33%)
FN3 507..>916 CDD:442628 13/41 (32%)
Ig strand F 511..516 CDD:409544 3/4 (75%)
Ig strand G 524..527 CDD:409544 0/2 (0%)
FN3 549..637 CDD:238020
fn3 770..855 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.