DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and robo1

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster


Alignment Length:324 Identity:86/324 - (26%)
Similarity:127/324 - (39%) Gaps:52/324 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRS 138
            |.|.:...:..:..|:.|...|.|......||.|.:.:        .|:....:||   .:|.:|
  Fly   255 PYFMKEPKDQVMLYGQTATFHCSVGGDPPPKVLWKKEE--------GNIPVSRARI---LHDEKS 308

  Fly   139 WYLHIKEVEETDRGWYMCQV-NTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKAR 202
              |.|..:..||.|.|:|:. |.....|.:..|.|..||...: ..||..|...|. :.|.|.|.
  Fly   309 --LEISNITPTDEGTYVCEAHNNVGQISARASLIVHAPPNFTK-RPSNKKVGLNGV-VQLPCMAS 369

  Fly   203 GYPEPYVMWRREDGEEMLI-----GGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPPSISKR 262
            |.|.|.|.|.:|....::.     |.:|| ..|| .|.||.|.:.....|:|.|.: |..|.:.|
  Fly   370 GNPPPSVFWTKEGVSTLMFPNSSHGRQHV-AADG-TLQITDVRQEDEGYYVCSAFS-VVDSSTVR 431

  Fly   263 VHLRVQF-----PPMLSIPNQLEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDK 322
            |.|:|..     ||::.|....:....|....|.|.....|:....|..: |..:     :||::
  Fly   432 VFLQVSSLDERPPPIIQIGPANQTLPKGSVATLPCRATGNPSPRIKWFHD-GHAV-----QAGNR 490

  Fly   323 YETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETD----------GNIKLDEMPTPTT 376
            |   |.:.|    ..|::..:..:|.|||.|.|....|||.          |:..|.....|:|
  Fly   491 Y---SIIQG----SSLRVDDLQLSDSGTYTCTASGERGETSWAATLTVEKPGSTSLHRAADPST 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 22/92 (24%)
IG_like 82..174 CDD:214653 23/92 (25%)
IG_like 184..267 CDD:214653 30/87 (34%)
IGc2 191..255 CDD:197706 22/68 (32%)
IG_like 282..368 CDD:214653 22/95 (23%)
Ig 288..367 CDD:143165 21/88 (24%)
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352
Ig2_Robo 159..251 CDD:143201
I-set 255..341 CDD:254352 24/98 (24%)
Ig3_Robo 272..341 CDD:143202 21/81 (26%)
IG_like 351..436 CDD:214653 30/88 (34%)
Ig 362..444 CDD:299845 27/84 (32%)
I-set 445..531 CDD:254352 23/98 (23%)
IGc2 459..521 CDD:197706 18/74 (24%)
FN3 549..637 CDD:238020
FN3 673..762 CDD:238020
fn3 770..855 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.