DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Lac

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:353 Identity:106/353 - (30%)
Similarity:162/353 - (45%) Gaps:51/353 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LAITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQEDSDFPRFAEPIANVTVSVGRDALM 93
            |||.:..|     |...|||::.|          ||:..::                 :|.....
  Fly    16 LAIFVQQT-----LAQRTPTISYI----------TQEQIKD-----------------IGGTVEF 48

  Fly    94 ACVVENLKGYKVAWVRVDTQTI-LSIHHNVISQNSRISLTYNDHRSWY-LHIKEVEETDRGWYMC 156
            .|.|:..|.|.|.:::.|:..: ||....::.::||.||.|:.:.|.| |.||:::|||.|.|.|
  Fly    49 DCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTC 113

  Fly   157 QV--NTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEPYVMWRREDGEEM 219
            ||  :|....|.:..|.|..||:|.:..|.: :|..||..:.:.|.|.|||.|.:.||||:  ..
  Fly   114 QVVISTVHKVSAEVKLSVRRPPVISDNSTQS-VVASEGSEVQMECYASGYPTPTITWRREN--NA 175

  Fly   220 LIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPPSISKRVHLRVQFPPMLSIPNQLEGAYL 284
            ::..:....| |..|.|..|.:.....|.|||.|||.....:.:::.|:|.|::::|....|..|
  Fly   176 ILPTDSATYV-GNTLRIKSVKKEDRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQAL 239

  Fly   285 GQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDKYETTS---TVSGYTKYMKLKIRAVGPN 346
            ..|:.||||.||||.....||.:       |...|.:::.:.|   |...||. ..|::..|...
  Fly   240 QYDMDLECHIEAYPPPAIVWTKD-------DIQLANNQHYSISHFATADEYTD-STLRVITVEKR 296

  Fly   347 DFGTYRCVAKNSLGETDGNIKLDEMPTP 374
            .:|.|.|.|.|..||.:..:.|.|...|
  Fly   297 QYGDYVCKATNRFGEAEARVNLFETIIP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 31/95 (33%)
Ig strand B 91..95 CDD:409353 0/3 (0%)
Ig strand C 104..108 CDD:409353 1/3 (33%)
Ig strand E 139..143 CDD:409353 2/4 (50%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 1/2 (50%)
Ig 176..267 CDD:472250 28/90 (31%)
Ig strand B 195..199 CDD:409301 0/3 (0%)
Ig strand C 208..212 CDD:409301 0/3 (0%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653 27/88 (31%)
Ig strand B 288..292 CDD:409353 1/3 (33%)
Ig strand C 301..305 CDD:409353 0/3 (0%)
Ig strand E 330..340 CDD:409353 3/9 (33%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
LacNP_523713.2 IG_like 36..131 CDD:214653 31/111 (28%)
Ig strand B 46..50 CDD:409381 0/3 (0%)
Ig strand C 60..63 CDD:409381 1/2 (50%)
Ig strand E 96..100 CDD:409381 2/3 (67%)
Ig strand F 110..115 CDD:409381 2/4 (50%)
Ig strand G 124..127 CDD:409381 1/2 (50%)
Ig_3 134..208 CDD:464046 26/77 (34%)
Ig 227..318 CDD:472250 29/98 (30%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 1/3 (33%)
Ig strand F 300..305 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.