DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and dpr19

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:340 Identity:72/340 - (21%)
Similarity:125/340 - (36%) Gaps:84/340 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MLMTAT-PTLAEIPSKGKH--TRLDTQQTAQEDSDFPRFAEPIANVTVSVGRDALMACVVENLKG 102
            :|:::| ..:.:|.|...|  ..|.:|...:.::          .|....|..|::.|||:....
  Fly    15 LLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNT----------RVIAQKGGLAILPCVVKVNSP 69

  Fly   103 YKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRS-WYLHIKEVEETDRGWYMCQVNTDPMRSR 166
            ..|:|:|.....:|::..:..|.:.|..:.:..|.. |.|.||.|.|.|||:|.||::..|.:| 
  Fly    70 ATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQS- 133

  Fly   167 KGYLQVVVPPIIVEGL----TSNDMVVREGQNISLVCKARGYPE--PYVMWRRE------DGEEM 219
                 :|:...|||.:    ::.::.:.|...:.|.||.:...|  .:|.|..:      |.:  
  Fly   134 -----IVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHDSKMINYDSQ-- 191

  Fly   220 LIGGEHV------NVVDGELLHITKVSRLHMAAYLCVASNGVPPSISKRVHLRVQFPPMLSIPNQ 278
              ||..|      |...|:....:..:: ..|.....:||||..|:                   
  Fly   192 --GGFVVTSIGQSNPQSGQFYRSSPANK-SRATMPMESSNGVLNSL------------------- 234

  Fly   279 LEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAV 343
                 ||....::......|:|..|.|.:.           ...|....:||      .|.::.|
  Fly   235 -----LGSSDAIKAPAANVPSSTPYMTQQH-----------QSAYLLNPSVS------VLTVKQV 277

  Fly   344 GPNDFGTYRCVAKNS 358
            .....|.|.|...|:
  Fly   278 NFRHAGNYTCAPSNA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 27/92 (29%)
IG_like 82..174 CDD:214653 27/92 (29%)
IG_like 184..267 CDD:214653 19/96 (20%)
IGc2 191..255 CDD:197706 16/77 (21%)
IG_like 282..368 CDD:214653 15/77 (19%)
Ig 288..367 CDD:143165 13/71 (18%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 25/76 (33%)
IGc2 55..125 CDD:197706 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.