DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and DIP-iota

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:299 Identity:150/299 - (50%)
Similarity:204/299 - (68%) Gaps:15/299 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DSDFPRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYN 134
            :|| |:|:.||.|.||.||||||:.|||.:|..:||||:||||||||||.::||::|.|||:::.
  Fly    28 NSD-PKFSGPINNSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHT 91

  Fly   135 DHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVC 199
            :||.|.|.|::|:|:||||||||:|||||:|:.|||.|||||.||:..||.|:|...|||::|.|
  Fly    92 EHRIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTC 156

  Fly   200 KARGYPEPYVMWRREDGEEMLI---GGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPPSISK 261
            .|.|.|.|.:.||||:...:||   |...|..|:|:.|.:.:|.|.||.||||:|||||||::||
  Fly   157 SATGVPMPTITWRREEATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTVSK 221

  Fly   262 RVHLRVQFPPMLSIPNQLEGAY--LGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDKYE 324
            ||.|.|.|.|  :|..:.:..|  |||.:.|||.||:.|||:|:|.  |...::.     |..||
  Fly   222 RVMLVVNFAP--TIWTRYDTIYVGLGQKLTLECITESQPASVNFWL--RDSQLLQ-----GGSYE 277

  Fly   325 TTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETD 363
            :.|....:...|::.:|.:...|||.|.|.|||::|:||
  Fly   278 SVSVDHVFRIVMRITLRPITKRDFGEYICRAKNAMGQTD 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 58/91 (64%)
Ig strand B 91..95 CDD:409353 2/3 (67%)
Ig strand C 104..108 CDD:409353 3/3 (100%)
Ig strand E 139..143 CDD:409353 2/3 (67%)
Ig strand F 153..158 CDD:409353 4/4 (100%)
Ig strand G 165..168 CDD:409353 1/2 (50%)
Ig 176..267 CDD:472250 47/93 (51%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 0/3 (0%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 4/4 (100%)
Ig strand G 260..263 CDD:409301 2/2 (100%)
IG_like 282..368 CDD:214653 32/84 (38%)
Ig strand B 288..292 CDD:409353 1/3 (33%)
Ig strand C 301..305 CDD:409353 1/3 (33%)
Ig strand E 330..340 CDD:409353 1/9 (11%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 1/1 (100%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 54/85 (64%)
Ig strand B 48..52 CDD:143290 2/3 (67%)
Ig strand C 61..65 CDD:143290 3/3 (100%)
Ig strand E 96..100 CDD:143290 2/3 (67%)
Ig strand F 110..115 CDD:143290 4/4 (100%)
Ig 133..227 CDD:472250 47/93 (51%)
Ig strand B 152..156 CDD:409562 1/3 (33%)
Ig strand C 165..169 CDD:409562 0/3 (0%)
Ig strand E 192..196 CDD:409562 1/3 (33%)
Ig strand F 206..211 CDD:409562 4/4 (100%)
Ig strand G 220..223 CDD:409562 2/2 (100%)
Ig_3 231..310 CDD:464046 29/87 (33%)

Return to query results.
Submit another query.