DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and DIP-eta

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_608946.3 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:461 Identity:190/461 - (41%)
Similarity:269/461 - (58%) Gaps:38/461 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RQLAITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQEDSDFPRFAEPIANVTVSVGRDA 91
            :|.....:....:.|.....|...|:|::   ..:|           |:|:.||.|:|..|||||
  Fly    10 KQTCALSVILLLILMSQQCYPQRVEVPAE---VIVD-----------PKFSSPIVNMTAPVGRDA 60

  Fly    92 LMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHIKEVEETDRGWYMC 156
            .:.|||::|..|||||:||||||||:|.::||::|.||.:..::|::|.:.||:::|:|:|||||
  Fly    61 FLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSEHKTWTMRIKDIKESDKGWYMC 125

  Fly   157 QVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEPYVMWRREDGEEM-L 220
            |:|||||:|:.|||.|||||.|::..||.|||||||.|::|.|.|.|.|||.:.||||.|..: |
  Fly   126 QINTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKCAATGSPEPTITWRRESGVPIEL 190

  Fly   221 IGGEHVNVVDGELLHITKVSRLHMAAYLCVASNGVPPSISKRVHLRVQFPPMLSIPNQLEGAYLG 285
            ..||.|..::|..|.|..|.|.||.||||:||||||||:|||:.|.|.||||:::.|||.||..|
  Fly   191 ATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMITVQNQLIGAVEG 255

  Fly   286 QDVILECHTEAYPASINYWTTERGDMIISDTSRAGDKYETTST-VSGYTKYMKLKIRAVGPNDFG 349
            :.|.|:|.:||||.||||||.|||:::     ..|.||....| :.||...|:|.|..:...:||
  Fly   256 KGVTLDCESEAYPKSINYWTRERGEIV-----PPGGKYSANVTEIGGYRNSMRLHINPLTQAEFG 315

  Fly   350 TYRCVAKNSLGETDGNIKLDEMPTPTTAIISEMSLLNRSYDGKRRHRNKFDSANALPDYGVEEWR 414
            :||||||||||:|||.|||..:|......:......::   ||:|.::   |.:..|....|  .
  Fly   316 SYRCVAKNSLGDTDGTIKLYRIPPNAVNYVENFEARHK---GKKRTKS---SESHHPARAQE--H 372

  Fly   415 DGAQGNNAGNNGDNNQTPVRNPPGAFHNS-AGSLAQHNLLAKIML--------GIKTQSFGIFKR 470
            .|....|.|....:......:....:.|| |||..:.:|...::|        .:...:.|:.:.
  Fly   373 SGEDMENPGKRKADLSLGAESIDSIYGNSAAGSRRRQDLGGVLLLLLPVAVAVAMSLATAGVMRE 437

  Fly   471 LSSSLP 476
            ...:||
  Fly   438 TQMTLP 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 52/91 (57%)
Ig strand B 91..95 CDD:409353 1/3 (33%)
Ig strand C 104..108 CDD:409353 3/3 (100%)
Ig strand E 139..143 CDD:409353 1/3 (33%)
Ig strand F 153..158 CDD:409353 4/4 (100%)
Ig strand G 165..168 CDD:409353 1/2 (50%)
Ig 176..267 CDD:472250 51/91 (56%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 0/3 (0%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 4/4 (100%)
Ig strand G 260..263 CDD:409301 2/2 (100%)
IG_like 282..368 CDD:214653 43/86 (50%)
Ig strand B 288..292 CDD:409353 2/3 (67%)
Ig strand C 301..305 CDD:409353 3/3 (100%)
Ig strand E 330..340 CDD:409353 4/9 (44%)
Ig strand F 350..355 CDD:409353 3/4 (75%)
Ig strand G 363..366 CDD:409353 2/2 (100%)
DIP-etaNP_608946.3 IG_like 51..137 CDD:214653 48/85 (56%)
Ig strand B 60..64 CDD:409353 1/3 (33%)
Ig strand C 73..77 CDD:409353 3/3 (100%)
Ig strand E 108..112 CDD:409353 1/3 (33%)
Ig strand F 122..127 CDD:409353 4/4 (100%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
IgI_1_MuSK 145..237 CDD:409562 51/91 (56%)
Ig strand A 145..148 CDD:409562 1/2 (50%)
Ig strand A' 153..158 CDD:409562 3/4 (75%)
Ig strand B 164..171 CDD:409562 2/6 (33%)
Ig strand C 177..182 CDD:409562 1/4 (25%)
Ig strand C' 184..186 CDD:409562 0/1 (0%)
Ig strand D 194..197 CDD:409562 1/2 (50%)
Ig strand E 202..208 CDD:409562 2/5 (40%)
Ig strand F 215..222 CDD:409562 4/6 (67%)
Ig strand G 229..237 CDD:409562 4/7 (57%)
IG_like 252..335 CDD:214653 44/87 (51%)
Ig strand B 258..262 CDD:409353 2/3 (67%)
Ig strand C 271..282 CDD:409353 8/10 (80%)
Ig strand E 301..306 CDD:409353 2/4 (50%)
Ig strand F 316..321 CDD:409353 3/4 (75%)
Ig strand G 329..332 CDD:409353 2/2 (100%)

Return to query results.
Submit another query.