DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DIP-kappa and itgb4

DIOPT Version :9

Sequence 1:	NP_723828.1	Gene:	DIP-kappa / 318958	FlyBaseID:	FBgn0051814	Length:	672	Species:	Drosophila melanogaster
Sequence 2:	XP_005166847.1	Gene:	itgb4 / 335269	ZFINID:	ZDB-GENE-030131-7209	Length:	1931	Species:	Danio rerio

Alignment Length:	122	Identity:	32/122 - (26%)
Similarity:	50/122 - (40%)	Gaps:	15/122 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly   400 DSANALPDYGVEEWRDGAQGNNAGNNGDNNQT-PVRNPPGAFHNSAGSLAQHNLLAKIMLGIKTQ 463
            |.||.|.  |:.:..|    .....|.|.|.| .||....:.......|.:||::.  :..:...
Zfish   270 DGANVLA--GILDRND----EQCHLNVDGNYTHDVRQDYPSIPTLVRLLVKHNIIP--IFAVTNH 326

  Fly   464 SFGIFKRLSSSLPLA-AGQ----SFLWLSTLSLVSAPSRWRMS-NVENRPNSPETVV 514
            |:..:::|....|:| .||    |...||.|.......|.::| ..|:||.:.||.:
Zfish   327 SYSYYEKLHEYFPIAELGQLQEDSSNILSILEKAFENIRSKISIRAEDRPKAVETKI 383

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DIP-kappa	NP_723828.1	Ig	80..172	CDD:299845
		IG_like	82..174	CDD:214653
		IG_like	184..267	CDD:214653
		IGc2	191..255	CDD:197706
		IG_like	282..368	CDD:214653
		Ig	288..367	CDD:143165
itgb4	XP_005166847.1	Integrin_beta	37..457	CDD:278776	32/122 (26%)
		EGF_2	<468..490	CDD:285248
		EGF_2	545..573	CDD:285248
		Integrin_B_tail	625..709	CDD:285239
		Calx-beta	991..1064	CDD:295344
		FN3	1242..1326	CDD:238020
		FN3	1331..1420	CDD:238020
		fn3	1640..1720	CDD:278470
		fn3	1751..1835	CDD:278470
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900