DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and dpr2

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:176 Identity:50/176 - (28%)
Similarity:80/176 - (45%) Gaps:29/176 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LDTQQTAQ----EDSDFP----RFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRVDTQTILS 117
            :|.::.|:    |::.:|    .|..| .|:|...|..|.:.|.|:||....|:|:|.....||:
  Fly    87 IDDEREAEEQPPEETTYPPPVFDFGMP-RNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILT 150

  Fly   118 IHHNVISQNSRISLTYN-DHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPP----I 177
            ......:.:.|..:... |.:.|.||:|..:..|.|.|.|||||:|..|....|.|:|.|    .
  Fly   151 AGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKA 215

  Fly   178 IVEGLTSNDMVVREGQNISLVCKAR-------------GYPEPYVM 210
            |:.|.|  |:.|:.|.:::|.|..:             .|..||::
  Fly   216 IIAGPT--DLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYIL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 31/92 (34%)
Ig strand B 91..95 CDD:409353 1/3 (33%)
Ig strand C 104..108 CDD:409353 1/3 (33%)
Ig strand E 139..143 CDD:409353 2/3 (67%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 1/2 (50%)
Ig 176..267 CDD:472250 12/52 (23%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301
Ig strand F 246..251 CDD:409301
Ig strand G 260..263 CDD:409301
IG_like 282..368 CDD:214653
Ig strand B 288..292 CDD:409353
Ig strand C 301..305 CDD:409353
Ig strand E 330..340 CDD:409353
Ig strand F 350..355 CDD:409353
Ig strand G 363..366 CDD:409353
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 31/93 (33%)
Ig strand A' 116..118 CDD:409355 0/1 (0%)
Ig strand B 122..130 CDD:409355 2/7 (29%)
CDR1 130..136 CDD:409355 3/5 (60%)
FR2 137..151 CDD:409355 5/13 (38%)
Ig strand C 137..143 CDD:409355 2/5 (40%)
Ig strand C' 149..153 CDD:409355 1/3 (33%)
CDR2 153..162 CDD:409355 0/8 (0%)
Ig strand D 162..167 CDD:409355 0/4 (0%)
FR3 163..192 CDD:409355 9/28 (32%)
Ig strand E 172..178 CDD:409355 3/5 (60%)
Ig strand F 186..192 CDD:409355 3/5 (60%)
IG_like 220..306 CDD:214653 9/42 (21%)
Ig strand B 231..235 CDD:409353 1/3 (33%)
Ig strand C 261..265 CDD:409353
Ig strand E 289..292 CDD:409353
Ig strand F 302..307 CDD:409353
Ig strand G 310..313 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.