DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and CG33543

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:384 Identity:88/384 - (22%)
Similarity:140/384 - (36%) Gaps:99/384 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TPTLAEIPSKGKHTRLDTQ------QTAQEDSDFPRFAEPIANVTVSVGRDALMACVVENLKGYK 104
            ||.|:..||....|....:      ||.|:|.| .::.:|.....             ||.||. 
  Fly    45 TPPLSLQPSTPSITHFVNESFIIFCQTVQKDID-TKWRDPRGQTR-------------ENTKGR- 94

  Fly   105 VAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRK-- 167
               |.::.:|           ...::|.:          :.:...|||.:.|:||.:...:|.  
  Fly    95 ---VHIEKKT-----------TGLLALVF----------EHIALEDRGNWTCEVNGNRNGNRNVN 135

  Fly   168 ------GYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKARGYPEPYVMWRREDGEEMLIGGEHV 226
                  ...:::|...|..|.|.....||||::..:.|...|.|.|.|.|        |..||::
  Fly   136 VEREFLASFELLVNQKISFGKTEQVQSVREGRDAMVNCFVEGMPAPEVSW--------LYNGEYI 192

  Fly   227 NVVDGEL-------LHITKVSRLHMAAYLCVASNGVPPSISK----RVHLRVQFPPML----SIP 276
            |.|:...       |:|..||:.....|.|.|.. :.|:.|.    .:.||:|..|..    ::|
  Fly   193 NTVNSTKHNRLSNGLYIRNVSQADAGEYTCRAMR-ITPTFSDSDQITILLRIQHKPHWFFNETLP 256

  Fly   277 NQLEGAYLGQDVILECHTEAYPASINYWTTERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIR 341
            .|.  ||:|..|.|.|.....|.....|......::         .:.....|:.|...::|:::
  Fly   257 VQY--AYVGGAVNLSCDAMGEPPPSFTWLHNNKGIV---------GFNHRIFVADYGATLQLQMK 310

  Fly   342 AVGPNDFGTYRCVAKNSLGETDGNIKLDEMPTPTTAIISEMSLLNRSYDGKRRHRNKFD 400
              ..:.||.|:|...|.||..:..|||...|.|         |..|.:..|:.:.|.|:
  Fly   311 --NASQFGDYKCKVANPLGMLERVIKLRPGPKP---------LGPRRFQLKKLYTNGFE 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 14/99 (14%)
Ig strand B 91..95 CDD:409353 0/3 (0%)
Ig strand C 104..108 CDD:409353 0/3 (0%)
Ig strand E 139..143 CDD:409353 0/3 (0%)
Ig strand F 153..158 CDD:409353 1/4 (25%)
Ig strand G 165..168 CDD:409353 1/10 (10%)
Ig 176..267 CDD:472250 28/101 (28%)
Ig strand B 195..199 CDD:409301 0/3 (0%)
Ig strand C 208..212 CDD:409301 1/3 (33%)
Ig strand E 232..236 CDD:409301 1/10 (10%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 1/6 (17%)
IG_like 282..368 CDD:214653 19/85 (22%)
Ig strand B 288..292 CDD:409353 2/3 (67%)
Ig strand C 301..305 CDD:409353 0/3 (0%)
Ig strand E 330..340 CDD:409353 2/9 (22%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 0/2 (0%)
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 15/90 (17%)
Ig strand E 105..109 CDD:409353 1/3 (33%)
Ig strand F 119..123 CDD:409353 0/3 (0%)
Ig 153..239 CDD:472250 26/94 (28%)
Ig strand B 169..173 CDD:409353 0/3 (0%)
Ig strand C 182..186 CDD:409353 2/11 (18%)
Ig strand E 205..209 CDD:409353 1/3 (33%)
Ig strand F 219..224 CDD:409353 2/4 (50%)
Ig strand G 232..235 CDD:409353 1/2 (50%)
IG_like 256..336 CDD:214653 22/92 (24%)
Ig strand B 266..270 CDD:409353 2/3 (67%)
Ig strand C 279..283 CDD:409353 0/3 (0%)
Ig strand E 302..309 CDD:409353 1/6 (17%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020 6/27 (22%)

Return to query results.
Submit another query.