DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and dpr4

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:206 Identity:62/206 - (30%)
Similarity:93/206 - (45%) Gaps:42/206 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 VTVSVGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTY-NDHR--------- 137
            ||.:||:.||:.|.|.||....|:|:|.....||::.          .||| ||.|         
  Fly    55 VTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVG----------ILTYTNDQRFQSLHSEGS 109

  Fly   138 -SWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNISLVCKA 201
             .|.|.|...:..|.|.|.|||:|:|..|:...|.|||....:.|  :.::.::.|.:|:|.|.|
  Fly   110 DEWTLRISSPQPRDSGTYECQVSTEPKISQGFRLNVV
VSRAKILG--NAELFIKSGSDINLTCLA 172

  Fly   202 RGYPEP--YVMWRREDGEEML----IGGEHVNVV------DGELLHITKVSRLHMAAYLCVASNG 254
            ...|.|  ::.|.:  |:.::    .||  :||:      ..:|| |.|.:......|.|..|:.
  Fly   173 MQSPVPPSFIYWYK--GKRVMNYSQRGG--INVITERSTRTSKLL-IAKATPADSGNYTCSPSSS 232

  Fly   255 VPPSISKRVHL 265
              .|.|..||:
  Fly   233 --DSASVVVHV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 34/99 (34%)
IG_like 82..174 CDD:214653 35/101 (35%)
IG_like 184..267 CDD:214653 24/94 (26%)
IGc2 191..255 CDD:197706 20/75 (27%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
dpr4NP_001014616.2 V-set 53..146 CDD:284989 34/100 (34%)
IG_like 53..145 CDD:214653 34/99 (34%)
ig 153..227 CDD:278476 19/80 (24%)
IG_like 161..>227 CDD:214653 18/70 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.