DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and CG6867

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster


Alignment Length:307 Identity:94/307 - (30%)
Similarity:142/307 - (46%) Gaps:26/307 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 VVVPPIIVEGLT---SNDMVVREGQNISLVCKARGYPEPYVMWRREDGEEMLIGGEHVNVVDGEL 233
            :::||.|.:...   ...::|.||::::|.|.|.|.|.|.|.||||||..:.:.|..:..:.|:.
  Fly   427 LLIPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTINVNGVEMASISGQF 491

  Fly   234 LHITKVSRLHMAAYLCVASNGVPPSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYP 298
            |..|.::|..||||.|.|:||:.|..:....:.|||.||:|:..|:..|.......|||..||:|
  Fly   492 LRFTNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSSATLECLVEAFP 556

  Fly   299 ASINYWTTERG-DMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGET 362
            .:|.||  ||. |..|.|.|   |||...|...|:...|:|.|..:..:|||.|.|||:|.|..|
  Fly   557 EAIRYW--ERAYDGKILDPS---DKYGIESYPEGFKTTMRLTISNLRKDDFGYYHCVARNELNAT 616

  Fly   363 DGNIKL-DEMPTPTTAIISEMSLLNRSYDGKRRHRNKFDSANALPDYGVEEWRDGAQGN---NAG 423
            ..|.:: .:.|...|..:..    |....|:|...::....:..||..:.:.:|....|   .|.
  Fly   617 MVNFEIAPQDPNSETPYVGN----NMKVYGQRPPESECPVCDQCPDPSLYQCKDSILNNFEIQAT 677

  Fly   424 NNGDNNQTPVRNPPGAFHNSAGSLAQHNLLAKIMLGIKTQSFGIFKR 470
            .|......|.| |...:..:.|....|.::        .:.||.:.|
  Fly   678 GNLSYPGLPKR-PKTCYLYAVGKPVFHKVV--------NEKFGSWLR 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 94/307 (31%)
IG_like 82..174 CDD:214653 0/1 (0%)
IG_like 184..267 CDD:214653 30/82 (37%)
IGc2 191..255 CDD:197706 27/63 (43%)
IG_like 282..368 CDD:214653 35/86 (41%)
Ig 288..367 CDD:143165 34/79 (43%)
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653 30/82 (37%)
IGc2 449..511 CDD:197706 26/61 (43%)
IG_like 544..612 CDD:214653 30/72 (42%)
Ig 546..612 CDD:143165 30/70 (43%)
OLF 694..937 CDD:280371 5/30 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11661
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26286
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.