DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and dpr8

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_727781.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:280 Identity:71/280 - (25%)
Similarity:108/280 - (38%) Gaps:63/280 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TPTLAEIPSKGKHTRLDTQQTAQEDSDFPRFAEPI-ANVTVSVGRDALMACVVENLKGYKVAWVR 109
            |..|.::|:.|              :..|.|...| .|:|..||:...:.|.|:||....|:|||
  Fly    28 TDFLQDLPTPG--------------TGGPTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVR 78

  Fly   110 VDTQTILSIHHNVISQNSRISLTYNDH-RSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVV 173
            .....:|::.....:.:.|....::.| ..|.|.|:..:..|.|.|.||::|.|......||.:|
  Fly    79 HRDIHLLTVGRYTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIV 143

  Fly   174 VPPIIVEGLTSNDMVVREGQNISLVCKARGYPE--PYVMW--RRE----DGEEMLIGGEHVNVVD 230
            .|  :.:.:...::.:..|..|:|.|..:..||  |.|:|  .||    |...   ||..:....
  Fly   144 EP--VTDIIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINFDSPR---GGISLVTEK 203

  Fly   231 GEL----LHITKVSRLHMAAYLCVASNGVPPSISKRVHL-----------------RVQFPPMLS 274
            |.|    |.:.|........|.|..||..|.|:  |||:                 ....||:| 
  Fly   204 GVLTTSRLLVQKAITQDSGLYTCTPSNANPTSV--RVHIVDGEHPAAMHTGNNGNSTASQPPVL- 265

  Fly   275 IPNQLEGAYLGQDVILECHT 294
            :|.          |:|.|.|
  Fly   266 LPL----------VLLTCST 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 27/92 (29%)
Ig strand B 91..95 CDD:409353 0/3 (0%)
Ig strand C 104..108 CDD:409353 1/3 (33%)
Ig strand E 139..143 CDD:409353 2/3 (67%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 0/2 (0%)
Ig 176..267 CDD:472250 27/119 (23%)
Ig strand B 195..199 CDD:409301 2/3 (67%)
Ig strand C 208..212 CDD:409301 2/5 (40%)
Ig strand E 232..236 CDD:409301 2/7 (29%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 0/2 (0%)
IG_like 282..368 CDD:214653 4/13 (31%)
Ig strand B 288..292 CDD:409353 2/3 (67%)
Ig strand C 301..305 CDD:409353
Ig strand E 330..340 CDD:409353
Ig strand F 350..355 CDD:409353
Ig strand G 363..366 CDD:409353
dpr8NP_727781.1 IG_like 51..131 CDD:214653 23/79 (29%)
Ig strand B 60..64 CDD:409353 0/3 (0%)
Ig strand C 73..77 CDD:409353 1/3 (33%)
Ig strand E 109..113 CDD:409353 2/3 (67%)
Ig strand F 123..128 CDD:409353 2/4 (50%)
Ig_3 153..230 CDD:464046 20/79 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.