Sequence 1: | NP_723828.1 | Gene: | DIP-kappa / 318958 | FlyBaseID: | FBgn0051814 | Length: | 672 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_848901.2 | Gene: | Skint4 / 320640 | MGIID: | 2444425 | Length: | 482 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 36/200 - (18%) |
---|---|---|---|
Similarity: | 76/200 - (38%) | Gaps: | 46/200 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 LAITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQEDSDF-------PRFAEPIANVTVS 86
Fly 87 VGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHIKEVEETDR 151
Fly 152 GWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNIS---LVCKARG-YPEPYVMWR 212
Fly 213 REDGE 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-kappa | NP_723828.1 | Ig | 80..172 | CDD:299845 | 13/91 (14%) |
IG_like | 82..174 | CDD:214653 | 13/91 (14%) | ||
IG_like | 184..267 | CDD:214653 | 11/37 (30%) | ||
IGc2 | 191..255 | CDD:197706 | 10/30 (33%) | ||
IG_like | 282..368 | CDD:214653 | |||
Ig | 288..367 | CDD:143165 | |||
Skint4 | NP_848901.2 | IG_like | 41..147 | CDD:214653 | 21/140 (15%) |
Ig_MOG_like | 49..148 | CDD:143190 | 18/130 (14%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |