DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Skint4

DIOPT Version :9

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_848901.2 Gene:Skint4 / 320640 MGIID:2444425 Length:482 Species:Mus musculus


Alignment Length:200 Identity:36/200 - (18%)
Similarity:76/200 - (38%) Gaps:46/200 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LAITIIATAAVTMLMTATPTLAEIPSKGKHTRLDTQQTAQEDSDF-------PRFAEPIANVTVS 86
            |.:..:::...|::.:..|.||.:   |.:..|:.|.:..:.:..       .|:.:|     |.
Mouse    25 LQMVALSSGHFTVIGSQRPILATL---GGNVELNCQLSPPQQAQHMEIRWFRNRYTQP-----VH 81

  Fly    87 VGRDALMACVVENLKGYKVAWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHIKEVEETDR 151
            :.|:.      :||.|..::              ..:.:...::..:|:.:. .|.|..|...|.
Mouse    82 LYRNG------KNLHGETMS--------------KYVERTELLTDAFNEGKV-ILRILNVTVDDG 125

  Fly   152 GWYMCQVNTDPMRSRKGYLQVVVPPIIVEGLTSNDMVVREGQNIS---LVCKARG-YPEPYVMWR 212
            |.|.|......      :.:..:..:.|...:|:..::....||.   |.|.:.| :|:|::.||
Mouse   126 GAYHCVFKDGE------FYEEHITEVKVTATSSDIQILMHTPNIKGVMLECHSGGWFPQPHMEWR 184

  Fly   213 REDGE 217
            ...||
Mouse   185 NSKGE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 Ig 80..172 CDD:299845 13/91 (14%)
IG_like 82..174 CDD:214653 13/91 (14%)
IG_like 184..267 CDD:214653 11/37 (30%)
IGc2 191..255 CDD:197706 10/30 (33%)
IG_like 282..368 CDD:214653
Ig 288..367 CDD:143165
Skint4NP_848901.2 IG_like 41..147 CDD:214653 21/140 (15%)
Ig_MOG_like 49..148 CDD:143190 18/130 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.