DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-kappa and Nrg

DIOPT Version :10

Sequence 1:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster


Alignment Length:488 Identity:99/488 - (20%)
Similarity:171/488 - (35%) Gaps:126/488 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 QTILSIHHNVISQNSRISLTYNDHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVPPI 177
            ||:.|.....|..:.||:   ..|....|.|::....|.|.|.|.|:.....::.  ..:::...
  Fly   277 QTVWSKDGQRIQWSDRIT---QGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQS--FSII
LNVN 336

  Fly   178 IVEGLTSNDMV--VREGQNISLVCKARGYPEPYVMW--------------RREDGEEMLIGGEHV 226
            .|...|....:  ..|.:.:...|:|.|.|||.:.|              ||...:..:   ..:
  Fly   337 SVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTDNTI---RII 398

  Fly   227 NVVDGELLHITKVSRLHMAAYLCVASNGVPPSISKRVHLRVQF-PPMLSIPNQLEGAYLGQDVIL 290
            |:|.|:           ...|.|.|:|.: ..:.|.|:|.||. ||.:|..........|::|.:
  Fly   399 NLVKGD-----------TGNYGCNATNSL-GYVYKDVYLNVQAEPPTISEAPAAVSTVDGRNVTI 451

  Fly   291 ECHTEAYPASINYWTTERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVA 355
            :|.....|..:..|       :.:.....|.:|...:...       |:|:.|..:|.|.|.|.|
  Fly   452 KCRVNGSPKPLVKW-------LRASNWLTGGRYNVQANGD-------LEIQDVTFSDAGKYTCYA 502

  Fly   356 KNSLGE--TDGNIKLDEMPTPTTAIISEMSLLNRSYDGKRRHRNKFDSANALPD---YGVEEWRD 415
            :|..||  .||::.:.|    .|.|..|    .::|:........|....|..|   ..::.|:|
  Fly   503 QNKFGEIQADGSLVVKE----HTRITQE----PQNYEVAAGQSATFRCNEAHDDTLEIEIDWWKD 559

  Fly   416 G------AQGNNAGNNGDNNQTPVRNPPGAFHNSAGSLAQHNLLAKIMLGIKTQSFGIFKRLSSS 474
            |      ||......| ||:.|                                       ::.:
  Fly   560 GQSIDFEAQPRFVKTN-DNSLT---------------------------------------IAKT 584

  Fly   475 LPLAAGQSFLWLSTLSLVSAPSRWRMSNVENRPNSPETVVNNDTAAECWETRSHCVSESNNNNNS 539
            :.|.:|: :..::...|..|.:|..:. |::.||:|:.     |...|...::....|...:|.|
  Fly   585 MELDSGE-YTCVARTRLDEATARANLI-VQDVPNAPKL-----TGITCQADKAEIHWEQQGDNRS 642

  Fly   540 RITQRPPMWARHLRI-FHIAHTPCGASTQYQRL 571
            .|.        |..| |:.:.||......|:::
  Fly   643 PIL--------HYTIQFNTSFTPASWDAAYEKV 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 14/60 (23%)
Ig strand B 91..95 CDD:409353
Ig strand C 104..108 CDD:409353
Ig strand E 139..143 CDD:409353 1/3 (33%)
Ig strand F 153..158 CDD:409353 2/4 (50%)
Ig strand G 165..168 CDD:409353 0/2 (0%)
Ig 176..267 CDD:472250 22/106 (21%)
Ig strand B 195..199 CDD:409301 0/3 (0%)
Ig strand C 208..212 CDD:409301 1/17 (6%)
Ig strand E 232..236 CDD:409301 0/3 (0%)
Ig strand F 246..251 CDD:409301 2/4 (50%)
Ig strand G 260..263 CDD:409301 1/2 (50%)
IG_like 282..368 CDD:214653 20/87 (23%)
Ig strand B 288..292 CDD:409353 1/3 (33%)
Ig strand C 301..305 CDD:409353 0/3 (0%)
Ig strand E 330..340 CDD:409353 1/9 (11%)
Ig strand F 350..355 CDD:409353 2/4 (50%)
Ig strand G 363..366 CDD:409353 2/2 (100%)
NrgNP_001245581.1 Ig 29..128 CDD:472250
Ig strand B 55..59 CDD:409353
Ig strand C 68..72 CDD:409353
Ig strand E 94..98 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 122..125 CDD:409353
Ig 137..216 CDD:472250
Ig strand B 151..155 CDD:409353
Ig strand C 165..169 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 209..214 CDD:409353
ig 251..332 CDD:395002 14/59 (24%)
Ig strand B 264..268 CDD:409353
Ig strand C 277..281 CDD:409353 2/3 (67%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 314..319 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 0/4 (0%)
IgI_4_hemolin-like 339..427 CDD:409570 21/102 (21%)
Ig strand A 339..342 CDD:409570 0/2 (0%)
Ig strand A' 348..351 CDD:409570 0/2 (0%)
Ig strand B 356..363 CDD:409570 1/6 (17%)
Ig strand C 369..374 CDD:409570 1/4 (25%)
Ig strand C' 377..379 CDD:409570 0/1 (0%)
Ig strand D 387..391 CDD:409570 2/3 (67%)
Ig strand E 393..397 CDD:409570 0/6 (0%)
Ig strand F 406..414 CDD:409570 3/7 (43%)
Ig strand G 417..427 CDD:409570 3/9 (33%)
Ig 446..517 CDD:472250 20/84 (24%)
Ig strand B 449..453 CDD:409358 1/3 (33%)
Ig strand C 462..466 CDD:409358 1/10 (10%)
Ig strand E 483..487 CDD:409358 1/10 (10%)
Ig strand F 497..502 CDD:409358 2/4 (50%)
Ig strand G 510..513 CDD:409358 0/2 (0%)
Ig 521..615 CDD:472250 22/139 (16%)
Ig strand B 538..542 CDD:409353 1/3 (33%)
Ig strand C 553..557 CDD:409353 0/3 (0%)
Ig strand E 577..581 CDD:409353 2/42 (5%)
Ig strand F 591..596 CDD:409353 0/5 (0%)
Ig strand G 604..607 CDD:409353 0/2 (0%)
FN3 613..707 CDD:238020 15/68 (22%)
FN3 683..>1051 CDD:442628
fn3 817..905 CDD:394996
fn3 918..1007 CDD:394996
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.