Sequence 1: | NP_723828.1 | Gene: | DIP-kappa / 318958 | FlyBaseID: | FBgn0051814 | Length: | 672 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001032740.2 | Gene: | Prtg / 315806 | RGDID: | 1307157 | Length: | 1193 | Species: | Rattus norvegicus |
Alignment Length: | 464 | Identity: | 84/464 - (18%) |
---|---|---|---|
Similarity: | 141/464 - (30%) | Gaps: | 188/464 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 MLMTATPTLAEIPSKGKHTRLDTQQTAQEDSDFPRFAEPIANVTVSVGRDALMACVVENLKGYKV 105
Fly 106 AWVRVDTQTILSIHHNVISQNSRISLTYNDHRSWYLHIKEV-----EETDRGWYM---------- 155
Fly 156 ---------------------------------CQVNTDP----------------MRSR----- 166
Fly 167 KGYLQV------------------------------VVP---------PIIVEGLTSNDMVVREG 192
Fly 193 QNISLVCKARGYPEPYVMWRREDGEEMLIGGEHVNVVDGELLHITKVSRLHMAAYLCVASNG--- 254
Fly 255 ------------VPPSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINYWTTE 307
Fly 308 RGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLDEMP 372
Fly 373 TPTTAIISE 381 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-kappa | NP_723828.1 | Ig | 80..172 | CDD:299845 | 25/160 (16%) |
IG_like | 82..174 | CDD:214653 | 26/190 (14%) | ||
IG_like | 184..267 | CDD:214653 | 23/97 (24%) | ||
IGc2 | 191..255 | CDD:197706 | 20/78 (26%) | ||
IG_like | 282..368 | CDD:214653 | 17/85 (20%) | ||
Ig | 288..367 | CDD:143165 | 17/78 (22%) | ||
Prtg | NP_001032740.2 | Ig | 32..124 | CDD:416386 | 20/117 (17%) |
Ig strand A | 32..35 | CDD:409353 | 1/2 (50%) | ||
Ig strand A' | 38..44 | CDD:409353 | 1/18 (6%) | ||
Ig strand B | 48..58 | CDD:409353 | 1/9 (11%) | ||
Ig strand C | 62..68 | CDD:409353 | 3/5 (60%) | ||
Ig strand C' | 70..73 | CDD:409353 | 0/11 (0%) | ||
Ig strand D | 78..83 | CDD:409353 | 2/4 (50%) | ||
Ig strand E | 85..91 | CDD:409353 | 2/9 (22%) | ||
Ig strand F | 103..110 | CDD:409353 | 2/6 (33%) | ||
Ig strand G | 114..124 | CDD:409353 | 0/9 (0%) | ||
Ig | 131..218 | CDD:416386 | 8/86 (9%) | ||
Ig strand B | 146..150 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 159..163 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 183..187 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 197..202 | CDD:409353 | 0/4 (0%) | ||
Ig strand G | 211..214 | CDD:409353 | 0/2 (0%) | ||
Ig_3 | 230..302 | CDD:404760 | 21/75 (28%) | ||
Ig strand B | 247..251 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 260..264 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 282..286 | CDD:409353 | 2/4 (50%) | ||
Ig strand F | 296..301 | CDD:409353 | 2/4 (50%) | ||
I-set | 322..407 | CDD:400151 | 24/119 (20%) | ||
Ig strand C | 352..357 | CDD:409353 | 1/16 (6%) | ||
Ig strand C' | 359..362 | CDD:409353 | 1/2 (50%) | ||
Ig strand D | 367..371 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 373..378 | CDD:409353 | 2/6 (33%) | ||
Ig strand F | 387..394 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 398..407 | CDD:409353 | 1/15 (7%) | ||
FN3 | 414..507 | CDD:238020 | |||
FN3 | 512..605 | CDD:238020 | |||
fn3 | 619..694 | CDD:394996 | |||
FN3 | 721..809 | CDD:238020 | |||
FN3 | 816..906 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 974..1018 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1078..1193 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR12231 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |